Overview

  • Product name

  • Description

    Rabbit polyclonal to TBP-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TBP-1 aa 1-300.
    Sequence:

    MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDS EIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD PNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDL VGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVE AIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLK LAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK


    Database link: P17980

  • Positive control

    • IHC-P: Human lung cancer and testis tissues. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/500 - 1/1000.
IHC-P 1/20 - 1/200.

Target

  • Function

    The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity). In case of HIV-1 infection, suppresses Tat-mediated transactivation.
  • Sequence similarities

    Belongs to the AAA ATPase family.
  • Post-translational
    modifications

    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 26S protease regulatory subunit 6A antibody
    • 26S proteasome AAA-ATPase subunit RPT5 antibody
    • Human immunodeficiency virus tat transactivator binding protein 1 antibody
    • MGC8487 antibody
    • Proteasome (prosome macropain) 26S subunit ATPase 3 antibody
    • Proteasome 26S ATPase subunit 3 antibody
    • Proteasome 26S subunit ATPase 3 antibody
    • Proteasome subunit P50 antibody
    • PRS6A_HUMAN antibody
    • PSMC 3 antibody
    • PSMC3 antibody
    • Tat binding protein 1 antibody
    • TAT-binding protein 1 antibody
    • TBP-1 antibody
    • TBP1 antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for TBP-1 (green) using ab239029 at 1/530 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. The nuclear counterstain was DAPI (blue).

  • Paraffin-embedded human testis tissue stained for TBP-1 using ab239029 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for TBP-1 using ab239029 at 1/100 dilution in immunohistochemical analysis.

References

ab239029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up