Overview

  • Product name

    Anti-TBP like protein TLP antibody
    See all TBP like protein TLP primary antibodies
  • Description

    Rabbit polyclonal to TBP like protein TLP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TBP like protein TLP aa 109-185.
    Sequence:

    CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSIT VTGPNVKAVATAVEQIYPFVFESRKEI


    Database link: P62380

  • Positive control

    • ICC/IF: SK-MEL-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells stained for TBP like protein TLP (green) using ab221857 at 4 µg/ml in ICC/IF.

References

ab221857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up