Anti-TBP like protein TLP antibody (ab238569)
Key features and details
- Rabbit polyclonal to TBP like protein TLP
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TBP like protein TLP antibody
See all TBP like protein TLP primary antibodies -
Description
Rabbit polyclonal to TBP like protein TLP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Chicken, Cow, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human TBP like protein TLP aa 1-186.
Sequence:MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMK LRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDF KVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQ IFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL
Database link: P62380 -
Positive control
- IHC-P: Human testis and heart tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238569 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Does not bind the TATA box. Has DNA-binding ability. -
Tissue specificity
Ubiquitously expressed, with highest levels in the testis and ovary. -
Sequence similarities
Belongs to the TBP family. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 395517 Chicken
- Entrez Gene: 613818 Cow
- Entrez Gene: 9519 Human
- Entrez Gene: 237336 Mouse
- Omim: 605521 Human
- SwissProt: Q9YGV8 Chicken
- SwissProt: Q32LB1 Cow
- SwissProt: Q4R848 Cynomolgus monkey
see all -
Alternative names
- 21 kDa TBP-like protein antibody
- 21kDa TBP like protein antibody
- Second TBP of unique DNA antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)
Paraffin-embedded human testis tissue stained for TBP like protein TLP using ab238569 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)
Paraffin-embedded human heart tissue stained for TBP like protein TLP using ab238569 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab238569 has not yet been referenced specifically in any publications.