Anti-TBP like protein TLP antibody (ab238569)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)

Key features and details

  • Rabbit polyclonal to TBP like protein TLP
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-TBP like protein TLP antibody
    See all TBP like protein TLP primary antibodies

  • Description

    Rabbit polyclonal to TBP like protein TLP

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow, Cynomolgus monkey, Orangutan

  • Immunogen

    Recombinant full length protein corresponding to Human TBP like protein TLP aa 1-186.
    Sequence:

    MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMK LRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDF KVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQ IFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL


    Database link: P62380
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human testis and heart tissue.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab238569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)

    Paraffin-embedded human testis tissue stained for TBP like protein TLP using ab238569 at 1/100 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TBP like protein TLP antibody (ab238569)

    Paraffin-embedded human heart tissue stained for TBP like protein TLP using ab238569 at 1/100 dilution in immunohistochemical analysis.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab238569? Please let us know so that we can cite the reference in this datasheet.

ab238569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab238569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com