Anti-Tbx2 antibody [4D6] (ab140345)
Key features and details
- Mouse monoclonal [4D6] to Tbx2
- Suitable for: IHC-P, IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Tbx2 antibody [4D6]
See all Tbx2 primary antibodies -
Description
Mouse monoclonal [4D6] to Tbx2 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, IP, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Tbx2 aa 554-702.
Sequence:ASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPAT SAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLAS EGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQR LVSGLESQR
Database link: Q13207 -
Positive control
- Human lung tissue.
-
General notes
We are constantly working hard to ensure we provide our customers with best in class antibodies. As a result, we are pleased to offer this antibody in a purified format as of 27th October 2017. The following lots are still unpurified and still in stock as of 27th October 2017- GR3184445-2, and GR224182-7. Lot numbers other than GR3184445-2, and GR224182-7 will be purified. Please note that the dilutions may need to be adjusted accordingly. Purified antibodies have the advantage of being enriched for the fraction of immunoglobulin that specifically reacts with the target antigen and for having a reduction of serum proteins.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
From tissue culture supernatant -
Clonality
Monoclonal -
Clone number
4D6 -
Myeloma
Sp2/0 -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140345 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use at an assay dependent concentration.
|
|
IP |
Use at an assay dependent concentration.
|
|
WB |
Use at an assay dependent concentration.
|
Notes |
---|
IHC-P
Use at an assay dependent concentration. |
IP
Use at an assay dependent concentration. |
WB
Use at an assay dependent concentration. |
Target
-
Function
Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation. -
Tissue specificity
Expressed primarily in adult in kidney, lung, and placenta. Weak expression in heart and ovary. -
Sequence similarities
Contains 1 T-box DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6909 Human
- Omim: 600747 Human
- SwissProt: Q13207 Human
- Unigene: 531085 Human
-
Alternative names
- FLJ10169 antibody
- HGNC:11597 antibody
- T box 2 antibody
see all
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab140345 has not yet been referenced specifically in any publications.