Overview

  • Product name

  • Description

    Rabbit polyclonal to Tbx20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Xenopus laevis, Zebrafish, Xenopus tropicalis
  • Immunogen

    Fusion protein corresponding to Human Tbx20 aa 1-297.
    Sequence:

    MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS CAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKI ACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPEAKYIVLM DIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQM VSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEE FRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIER


    Database link: BC120946

  • Positive control

    • K562 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 33, 49 kDa.

Target

Images

  • Anti-Tbx20 antibody (ab197386) at 1/500 dilution + K562 cell lysate at 40 µg

    Predicted band size: 33, 49 kDa


    Exposure time: 40 seconds


    8% SDS-PAGE

References

ab197386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up