Overview

  • Product name

  • Description

    Rabbit polyclonal to TBX5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TBX5 aa 247-363.
    Sequence:

    MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENG VSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETS PSEEDSFYRSSYPQQQG


    Database link: Q99593

  • Positive control

    • IHC-P: Human heart muscle, lung and placenta tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab223760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
  • Involvement in disease

    Defects in TBX5 are the cause of Holt-Oram syndrome (HOS) [MIM:142900]. HOS is a developmental disorder affecting the heart and upper limbs. It is characterized by thumb anomaly and atrial septal defects.
  • Sequence similarities

    Contains 1 T-box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Holt Oram syndrome antibody
    • HOS antibody
    • T box 5 antibody
    • T box protein 5 antibody
    • T box transcription factor TBX 5 antibody
    • T box transcription factor TBX5 antibody
    • T-box protein 5 antibody
    • T-box transcription factor TBX5 antibody
    • TBX 5 antibody
    • TBX5 antibody
    • TBX5_HUMAN antibody
    • Transcription factor T box 5 antibody
    see all

Images

  • Paraffin embedded sections of human heart muscle tissue stained for TBX5 with ab223760 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human lung tissue stained for TBX5 with ab223760 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human placenta tissue stained for TBX5 with ab223760 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin embedded sections of human heart pancreas tissue were stained for TBX5 with ab223760 at 1/50 dilution in immunohistochemical analysis.

    Negative control: no staining observed.

References

ab223760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up