Anti-TC-2 antibody (ab189871)
Key features and details
- Rabbit polyclonal to TC-2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TC-2 antibody
See all TC-2 primary antibodies -
Description
Rabbit polyclonal to TC-2 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TC-2 aa 19-250.
Sequence:EMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTK EDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEF VRGHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQ KRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQR ITMAIRTVREEILKAQTPEGHFGNVYSTPLAL
Database link: P20062 -
Positive control
- SW480, MCF7, A549, U-251MG cell line extracts; Mouse kidney and lung tissue extracts
-
General notes
Previously labelled as TCN2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab189871 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 48 kDa. |
Target
-
Function
Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells. -
Involvement in disease
Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency) [MIM:275350]. This results in various forms of anemia. -
Sequence similarities
Belongs to the eukaryotic cobalamin transport proteins family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 6948 Human
- Omim: 275350 Human
- SwissProt: P20062 Human
- Unigene: 417948 Human
-
Alternative names
- D22S676 antibody
- D22S750 antibody
- II antibody
see all
Images
-
All lanes : Anti-TC-2 antibody (ab189871) at 1/500 dilution
Lane 1 : SW620 cell extracts
Lane 2 : MCF7 cell extracts
Lane 3 : A549 cell extracts
Lane 4 : U-25MG cell extracts
Lane 5 : Mouse kidney tissue extracts
Lane 6 : Mouse lung tissue extracts
Predicted band size: 48 kDa
Datasheets and documents
References (0)
ab189871 has not yet been referenced specifically in any publications.