For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tc-2-antibody-ab189871.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Serum Proteins
Share by email

Anti-TC-2 antibody (ab189871)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-TC-2 antibody (ab189871)

    Key features and details

    • Rabbit polyclonal to TC-2
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-TC-2 antibody
      See all TC-2 primary antibodies
    • Description

      Rabbit polyclonal to TC-2
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
    • Immunogen

      Recombinant fragment corresponding to Human TC-2 aa 19-250.
      Sequence:

      EMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTK EDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEF VRGHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQ KRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQR ITMAIRTVREEILKAQTPEGHFGNVYSTPLAL


      Database link: P20062
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • SW480, MCF7, A549, U-251MG cell line extracts; Mouse kidney and lung tissue extracts
    • General notes

      Previously labelled as TCN2. 

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: 49% PBS, 50% Glycerol
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cardiovascular
      • Blood
      • Serum Proteins
      • Signal Transduction
      • Metabolism
      • Vitamins / Minerals
      • Metabolism
      • Pathways and Processes
      • Cofactors, Vitamins / minerals
      • Vitamins / minerals

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • Mouse lung normal tissue lysate - total protein (ab29297)
      • Mouse kidney normal tissue lysate - total protein (ab29305)
      • MCF7 whole cell lysate (ab29537)
      • SW480 whole cell lysate (ab3957)
      • A549 whole cell lysate (ab7910)

    Applications

    Our Abpromise guarantee covers the use of ab189871 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.

    Target

    • Function

      Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells.
    • Involvement in disease

      Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency) [MIM:275350]. This results in various forms of anemia.
    • Sequence similarities

      Belongs to the eukaryotic cobalamin transport proteins family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P20062 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 6948 Human
      • Omim: 275350 Human
      • SwissProt: P20062 Human
      • Unigene: 417948 Human
      • Alternative names

        • D22S676 antibody
        • D22S750 antibody
        • II antibody
        • Macrocytic anemia antibody
        • OTTHUMP00000199117 antibody
        • OTTHUMP00000199118 antibody
        • OTTHUMP00000199119 antibody
        • TC antibody
        • TC II antibody
        • TC II deficiency antibody
        • TC-2 antibody
        • TC2 antibody
        • TCII antibody
        • TCN2 antibody
        • TCN2 deficiency antibody
        • TCO2_HUMAN antibody
        • Transcobalamin 2 antibody
        • Transcobalamin 2 deficiency antibody
        • Transcobalamin II antibody
        • Transcobalamin II; macrocytic anemia antibody
        • Transcobalamin-2 antibody
        • Vitamin B12 binding protein 2 antibody
        see all

      Images

      • Western blot - Anti-TC-2 antibody (ab189871)
        Western blot - Anti-TC-2 antibody (ab189871)
        All lanes : Anti-TC-2 antibody (ab189871) at 1/500 dilution

        Lane 1 : SW620 cell extracts
        Lane 2 : MCF7 cell extracts
        Lane 3 : A549 cell extracts
        Lane 4 : U-25MG cell extracts
        Lane 5 : Mouse kidney tissue extracts
        Lane 6 : Mouse lung tissue extracts

        Predicted band size: 48 kDa

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab189871? Please let us know so that we can cite the reference in this datasheet.

      ab189871 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab189871.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.