Overview

  • Product name

  • Description

    Rabbit polyclonal to TC-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Rat TC-2 aa 19-427. (Expressed in E.coli).
    Sequence:

    EFCVIPKMDGQLVEKLGQRLLPWMDRLSSEQLNPSIYVGLRLSSMQAGTK ENLYLHNLKLHYQQCLLRSTSSDDNSGCQTKISGGSLALYLLALRANCEL LGSRKGDRMVSQLKWFLEDEKKAIGHHHEGHPHTSYYQYGLSILALCVHR KRVHDSVVGKLLYAVEHDYFTYQGHLSVDTEAMAGLAFTCLERFNFNSDL RPRITTAIETVREKILKAQAPEGYFGNIYSTPLALQMLMTSPGVGLGPAC LKARKSLLLSLQDGAFQNPMMISQLLPVLNHKTYLNLISPDCQAPRVMLV PATEDPVHLSEVSVTLKVSSVLPPYERTVSVFAGASLEDVLNRARDLGEF TYGTQASLSGPYLTSVLGKEAGDREYWQLLRVPDTPLLQGIADYKPKNGE TIELRLVKM


    Database link: Q9R0D6

  • Positive control

    • WB: Recombinant rat TC-2 protein; Rat serum. IHC-P: Rat prostate gland tissue.
  • General notes

    Previously labelled as TCN2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab233429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells.
  • Involvement in disease

    Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency) [MIM:275350]. This results in various forms of anemia.
  • Sequence similarities

    Belongs to the eukaryotic cobalamin transport proteins family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Alternative names

    • D22S676 antibody
    • D22S750 antibody
    • II antibody
    • Macrocytic anemia antibody
    • OTTHUMP00000199117 antibody
    • OTTHUMP00000199118 antibody
    • OTTHUMP00000199119 antibody
    • TC antibody
    • TC II antibody
    • TC II deficiency antibody
    • TC-2 antibody
    • TC2 antibody
    • TCII antibody
    • TCN2 antibody
    • TCN2 deficiency antibody
    • TCO2_HUMAN antibody
    • Transcobalamin 2 antibody
    • Transcobalamin 2 deficiency antibody
    • Transcobalamin II antibody
    • Transcobalamin II; macrocytic anemia antibody
    • Transcobalamin-2 antibody
    • Vitamin B12 binding protein 2 antibody
    see all

Images

  • Anti-TC-2 antibody (ab233429) at 2 µg/ml + Recombinant rat TC-2 protein

    Predicted band size: 47 kDa

  • Anti-TC-2 antibody (ab233429) at 2 µg/ml + Rat serum

    Predicted band size: 47 kDa

  • Formalin-fixed, paraffin-embedded rat prostate gland tissue stained for TC-2 using ab233429 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up