Overview

  • Product name

  • Description

    Rabbit polyclonal to TCF-4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment within Human TCF-4 aa 400-500. The exact sequence is proprietary.
    Sequence:

    LRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSL MVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPP G


    Database link: P15884

  • Positive control

    • WB: K562 cell extract. IHC-P: Mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 71 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF 1/50 - 1/200.

Target

  • Function

    Transcription factor that binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription (By similarity). Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.
  • Tissue specificity

    Expressed in adult heart, brain, placenta, skeletal muscle and to a lesser extent in the lung. In developing embryonic tissues, expression mostly occurs in the brain.
  • Involvement in disease

    Defects in TCF4 are a cause of Pitt-Hopkins syndrome (PTHS) [MIM:610954]. PTHS is a rare syndromic encephalopathy characterized by severe psychomotor delay, epilepsy, daily bouts of diurnal hyperventilation starting in infancy, mild postnatal growth retardation, postnatal microcephaly, and distinctive facial features. Since most hitherto reported cases have been sporadic, with males and females equally affected, PTHS is regarded as an autosomal dominant condition.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain

    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHb19 antibody
    • Class B basic helix-loop-helix protein 19 antibody
    • E2 2 antibody
    • FECD3 antibody
    • Immunoglobulin transcription factor 2 antibody
    • ITF 2 antibody
    • ITF-2 antibody
    • ITF2 antibody
    • ITF2_HUMAN antibody
    • MGC149723 antibody
    • MGC149724 antibody
    • PTHS antibody
    • SEF 2 antibody
    • SEF-2 antibody
    • SEF2 1 antibody
    • SEF2 1A antibody
    • SEF2 1B antibody
    • SEF2 1D antibody
    • SEF2 antibody
    • SL3 3 enhancer factor 2 antibody
    • SL3-3 enhancer factor 2 antibody
    • TCF 4 antibody
    • TCF-4 antibody
    • TCF4 antibody
    • Transcription factor 4 antibody
    • Transcription factor 4, isoform C antibody
    • Transcription factor 4, isoform D antibody
    • Transcription factor 4, isoform E antibody
    • Transcription factor 4, isoform L antibody
    • Transcription factor 4, isoform M antibody
    • Transcription factor 4, isoform R antibody
    see all

Images

  • Anti-TCF-4 antibody (ab185736) at 1/500 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow ) cell extract

    Predicted band size: 71 kDa

  • Ab185736 staining TCF-4 in HeLa cells by ICC/IF (Immunocytochemistry/Immunofluorescence). Samples were incubated with primary antibody at 2.31 mg/ml concentration. DAPI (100µg/ml) was used as a nuclear stain.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse brain tissue labelling TCF-4 with ab185736. Magnification: 200X.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse brain tissue labelling TCF-4 with ab185736. Magnification: 400X.

References

This product has been referenced in:

  • Xue H  et al. miR-93-5p attenuates IL-1ß-induced chondrocyte apoptosis and cartilage degradation in osteoarthritis partially by targeting TCF4. Bone 123:129-136 (2019). Read more (PubMed: 30930294) »
  • Chen C & Shan H Keratin 6A gene silencing suppresses cell invasion and metastasis of nasopharyngeal carcinoma via the ß-catenin cascade. Mol Med Rep 19:3477-3484 (2019). Read more (PubMed: 30896882) »
See all 11 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up