Overview

  • Product name

  • Description

    Rabbit polyclonal to TCF19/SC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human TCF19/SC1 aa 1-290.
    Sequence:

    MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEP GLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGD LLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSRGEARVGAGFR PMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPK SLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLME PRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGE


    Database link: Q9Y242

  • Positive control

    • WB: HEK-293T whole cell lysate; Rat thymus tissue lysate. IHC-P: Human testis tissue.
  • General notes

     This product was previously labelled as TCF19

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 37 kDa (predicted molecular weight: 37 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-TCF19/SC1 antibody (ab230005) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : Rat thymus lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 37 kDa
    Observed band size: 37 kDa

  • Paraffin-embedded human testis tissue stained for TCF19/SC1 using ab230005 at 1/100 dilution in immunohistochemical analysis.

References

ab230005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up