Overview

  • Product name

  • Description

    Rabbit polyclonal to TCF19/SC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human TCF19/SC1 aa 296-359. (AAB60363)
    Sequence:

    VAACPRKRQWPGFSVMAVTSGSMWPVLAAASRLPGRPTSDAQGAGLAFSL RSTAKAPSDTPAHE

  • Positive control

    • 293T whole cell lysate
  • General notes

     This product was previously labelled as TCF19

     

Properties

Applications

Our Abpromise guarantee covers the use of ab96828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Potential trans-activating factor that could play an important role in the transcription of genes required for the later stages of cell cycle progression.
  • Sequence similarities

    Contains 1 FHA domain.
    Contains 1 PHD-type zinc finger.
  • Developmental stage

    Growth regulated.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • SC 1 antibody
    • SC1 antibody
    • TCF 19 antibody
    • TCF-19 antibody
    • Tcf19 antibody
    • TCF19_HUMAN antibody
    • Transcription factor 19 antibody
    • Transcription factor SC1 antibody
    see all

Images

  • Anti-TCF19/SC1 antibody (ab96828) at 1/1500 dilution + 293T whole cell lysate at 30 µg

    Predicted band size: 37 kDa



    10% SDS-PAGE

References

ab96828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up