Overview

  • Product name

  • Description

    Rabbit polyclonal to TCF7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human TCF7 aa 228-277 (internal sequence). The exact sequence is proprietary.
    Sequence:

    PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM


    Database link: P36402

  • Positive control

    • WB: fetal thymus lysate. IHC-P: human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab30961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 0.125 µg/ml. Detects a band of approximately 49 kDa (predicted molecular weight: 42 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. May also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7 and CTNNB1.
  • Tissue specificity

    Predominantly in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium.
  • Sequence similarities

    Belongs to the TCF/LEF family.
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ36364 antibody
    • MGC47735 antibody
    • OTTHUMP00000159391 antibody
    • T cell factor 1 antibody
    • T cell specific transcription factor 1 antibody
    • T-cell factor 1 antibody
    • T-cell-specific transcription factor 1 antibody
    • TCF-1 antibody
    • TCF-7 antibody
    • TCF1 antibody
    • Tcf7 antibody
    • TCF7 transcription factor 7 antibody
    • TCF7_HUMAN antibody
    • Transcription factor 7 (T cell specific HMG box) antibody
    • Transcription factor 7 antibody
    • Transcription factor-7, T-cell specific antibody
    • Transcription factor-7, T-cell specific, 1 antibody
    see all

Images

  • Anti-TCF7 antibody (ab30961) at 0.125 µg/ml + fetal thymus lysate at 10 µg/ml

    Secondary
    HRP conjugated anti rabbit IgG at a dilution of 1/ 50,000 - 1/100,000

    Developed using the ECL technique.

    Predicted band size: 42 kDa
    Observed band size: 49 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 25 kDa. We are unsure as to the identity of these extra bands.

  • Immunohistochemistry (Formalin/PFA-fixed parraffin-embedded sections) analysis of human kidney tissue labelling Transcription factor 7 with ab30961 at 4-8µg/ml. Positively labelled cells (epithelial cells of renal tubule) are indicated by arrows. Magnification: 400X.

References

This product has been referenced in:

  • Wu B  et al. Down-regulation of lncTCF7 inhibits cell migration and invasion in colorectal cancer via inhibiting TCF7 expression. Hum Cell 32:31-40 (2019). Read more (PubMed: 30225781) »
  • Yu F  et al. Evaluation of expression of the Wnt signaling components in canine mammary tumors via RT2Profiler PCR Array and immunochemistry assays. J Vet Sci 18:359-367 (2017). Read more (PubMed: 27586466) »
See all 4 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Intestine)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH 6.0
Permeabilization
No
Specification
Intestine
Blocking step
Normal horse serum as blocking agent for 30 minute(s) · Concentration: 2.5% · Temperature: 25°C
Fixative
Formaldehyde

Eliran Kadosh

Verified customer

Submitted May 15 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Dog Tissue sections (lymph node)
Antigen retrieval step
Enzymatic - Buffer/Enzyme Used: Proteinase K
Permeabilization
No
Specification
lymph node
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 23°C
Fixative
Formaldehyde

Frau Dr. Martina Dettwiler

Verified customer

Submitted Nov 22 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up