Anti-TCFL5 antibody (ab188075)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TCFL5 antibody
See all TCFL5 primary antibodies -
Description
Rabbit polyclonal to TCFL5 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human TCFL5 aa 341-418.
Sequence:KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQA QSGPQGGRSQRRERHNRMERDRRRRIRI
Database link: Q9UL49 -
Positive control
- Human stomach tissue; RT-4 and U-251 cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab188075 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/1000. Predicted molecular weight: 53 kDa. | |
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Putative transcription factor. Isoform 3 may play a role in early spermatogenesis. -
Tissue specificity
Isoform 3 is testis specific. Isoform 2 is pancreas specific. -
Sequence similarities
Contains 1 bHLH (basic helix-loop-helix) domain. -
Developmental stage
Isoform 3 is specifically expressed in primary spermatocytes at the pachytene stage, but not those at leptonema stage. Not expressed in other testicular cells, including spermatogonia located in the basal compartment of the seminiferous tubule or spermatids. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 10732 Human
- Entrez Gene: 277353 Mouse
- Entrez Gene: 311715 Rat
- Omim: 604745 Human
- SwissProt: Q9UL49 Human
- Unigene: 126248 Human
- Unigene: 473700 Mouse
-
Alternative names
- bHLHe82 antibody
- CHA antibody
- Cha transcription factor antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCFL5 antibody (ab188075)Immunohistochemical analysis of paraffin-embedded Human stomach tissue, labeling TCFL5 using ab188075 at a 1/1000 dilution.
-
Western blot - Anti-TCFL5 antibody (ab188075)All lanes : Anti-TCFL5 antibody (ab188075) at 1/500 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG sp cell lysate
Predicted band size: 53 kDa
Datasheets and documents
References
ab188075 has not yet been referenced specifically in any publications.
