Anti-TCFL5 antibody (ab188075)
Key features and details
- Rabbit polyclonal to TCFL5
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TCFL5 antibody -
Description
Rabbit polyclonal to TCFL5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human TCFL5 aa 341-418.
Sequence:KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQA QSGPQGGRSQRRERHNRMERDRRRRIRI
Database link: Q9UL49 -
Positive control
- IHC-P: Human testis and cerebral cortex tissue; ICC: Hep G2 whole cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab188075 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Putative transcription factor. Isoform 3 may play a role in early spermatogenesis. -
Tissue specificity
Isoform 3 is testis specific. Isoform 2 is pancreas specific. -
Sequence similarities
Contains 1 bHLH (basic helix-loop-helix) domain. -
Developmental stage
Isoform 3 is specifically expressed in primary spermatocytes at the pachytene stage, but not those at leptonema stage. Not expressed in other testicular cells, including spermatogonia located in the basal compartment of the seminiferous tubule or spermatids. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 10732 Human
- Entrez Gene: 277353 Mouse
- Entrez Gene: 311715 Rat
- Omim: 604745 Human
- SwissProt: Q9UL49 Human
- Unigene: 126248 Human
- Unigene: 473700 Mouse
-
Alternative names
- bHLHe82 antibody
- CHA antibody
- Cha transcription factor antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCFL5 antibody (ab188075)
Immunohistochemical analysis of human testis tissue labeling TCFL5 in the nucleus of cells in seminiferous ducts with ab188075 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemical analysis of HepG2 (Human liver hepatocellular carcinoma cell line) whole cells labeling TCFL5 with ab188075 at 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCFL5 antibody (ab188075)
Immunohistochemical analysis of human cerebral cortex tissue labeling TCFL5 in the nucleus of neurons with ab188075 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCFL5 antibody (ab188075)
Immunohistochemical analysis of human pancreas tissue labeling TCFL5 with ab188075 at a 1/500 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCFL5 antibody (ab188075)
Immunohistochemical analysis of human liver tissue labeling TCFL5 with ab188075 at a 1/500 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
Datasheets and documents
References (0)
ab188075 has not yet been referenced specifically in any publications.