Overview

  • Product name

  • Description

    Rabbit polyclonal to TCIRG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TCIRG1 aa 666-721.
    Sequence:

    RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMH QAIHTI


    Database link: Q13488

  • Positive control

    • IHC-P: Human bone marrow tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Part of the proton channel of V-ATPases (By similarity). Seems to be directly involved in T-cell activation.
  • Tissue specificity

    Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus.
  • Involvement in disease

    Defects in TCIRG1 are the cause of osteopetrosis autosomal recessive type 1 (OPTB1) [MIM:259700]; also called autosomal recessive Albers-Schonberg disease or infantile malignant osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. The features of OPTB1 are macrocephaly, progressive deafness and blindness, hepatosplenomegaly, and severe anemia beginning in early infancy or in fetal life. Deafness and blindness are generally thought to represent effects of pressure on nerves.
  • Sequence similarities

    Belongs to the V-ATPase 116 kDa subunit family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • a3 antibody
    • Atp 6i antibody
    • Atp6i antibody
    • ATP6N1C antibody
    • ATP6V0A3 antibody
    • ATPase H+ transporting 116kD antibody
    • OC 116 antibody
    • OC 116 kDa antibody
    • OC 116kDa antibody
    • OC-116 kDa antibody
    • OC116 antibody
    • OPTB 1 antibody
    • OPTB1 antibody
    • Osteoclastic proton pump 116 kDa subunit antibody
    • Specific 116 kDa vacuolar proton pump subunit antibody
    • Stv 1 antibody
    • Stv1 antibody
    • T cell immune regulator 1 antibody
    • T cell immune regulator 1 ATPase H+ transporting lysosomal V0 subunit A antibody
    • T cell immune regulator 1 ATPase H+ transporting lysosomal V0 subunit A3 antibody
    • T cell immune response cDNA 7 antibody
    • T cell immune response cDNA7 protein antibody
    • T cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a antibody
    • T-cell immune regulator 1 antibody
    • T-cell immune response cDNA7 protein antibody
    • TCIRG 1 antibody
    • TCIRG1 antibody
    • TIRC 7 antibody
    • TIRC7 antibody
    • V ATPase 116 kDa antibody
    • V ATPase 116 kDa isoform a3 antibody
    • V type proton ATPase 116 kDa subunit a antibody
    • V-ATPase 116 kDa isoform a3 antibody
    • V-type proton ATPase 116 kDa subunit a isoform 3 antibody
    • Vacuolar proton translocating ATPase 116 kDa subunit A antibody
    • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3 antibody
    • Vph 1 antibody
    • Vph1 antibody
    • VPP3_HUMAN antibody
    see all

Images

  • Paraffin-embedded human bone marrow tissue stained for TCIRG1 using ab224654 at 1/200 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TCIRG1 (green) using ab224654 at 4 µg/ml in ICC/IF.

References

ab224654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up