Overview

  • Product name

  • Description

    Rabbit polyclonal to Tcl1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Tcl1 aa 1-114.
    Sequence:

    MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL LRREDVVLGR PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHI KIDGVEDMLLELLPDD


    Database link: P56279

  • Positive control

    • Ramos cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab181403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 13 kDa.

Target

  • Function

    Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
  • Tissue specificity

    Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
  • Involvement in disease

    Note=Chromosomal aberrations activating TCL1A are found in chronic T-cell leukemias (T-CLL). Translocation t(14;14)(q11;q32); translocation t(7;14)(q35;q32); inversion inv(14)(q11;q32) that involves the T-cell receptor alpha/delta loci.
  • Sequence similarities

    Belongs to the TCL1 family.
  • Cellular localization

    Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum. Microsomal fraction.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anti TCL1A antibody
    • Lymphoma/leukemia, T-cell antibody
    • Oncogene TCL-1 antibody
    • Oncogene TCL1 antibody
    • P14 TCL1 antibody
    • P14 TCL1 protein antibody
    • Protein p14 TCL1 antibody
    • T cell leukemia 1 antibody
    • T cell lymphoma 1 antibody
    • T cell lymphoma 1A antibody
    • T-cell leukemia/lymphoma 1A antibody
    • T-cell leukemia/lymphoma protein 1A antibody
    • TCL 1 protein antibody
    • TCL1 antibody
    • TCL1 oncogene antibody
    • TCL1 PEN antibody
    • Tcl1a antibody
    • TCL1A antibody antibody
    • TCL1A_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat lung tissue labelling Tcl1 with ab181403 at 1/100. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat brain tissue labelling Tcl1 with ab181403 at 1/100. Magnification: 400x.

References

ab181403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up