Overview

  • Product name

  • Description

    Rabbit polyclonal to TCN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TCN1 aa 1-433.
    Sequence:

    MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNR GTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIIL ALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLD VLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKK SLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQA LFVSSDYYNENDWNCQQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL DINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRT YWELLSGGEPLSQGAGSYVVRNGENLEVRWSKY


    Database link: P20061

  • Positive control

    • U2OS cells; BT474 and HT-29 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.
ICC/IF Use at an assay dependent dilution.
IHC-P 1/50 - 1/200.

Target

  • Function

    Vitamin B12-binding protein. Transports cobalamin into cells.
  • Tissue specificity

    Neutrophil granule protein.
  • Sequence similarities

    Belongs to the eukaryotic cobalamin transport proteins family.
  • Post-translational
    modifications

    Contains about 30% carbohydrates.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Haptocorin antibody
    • Haptocorrin antibody
    • HC antibody
    • OTTHUMP00000235879 antibody
    • TC 1 antibody
    • TC I antibody
    • TC-1 antibody
    • TC1 antibody
    • TCI antibody
    • TCN 1 antibody
    • TCN1 antibody
    • TCO1_HUMAN antibody
    • Transcobalamin 1 antibody
    • Transcobalamin I antibody
    • Transcobalamin-1 antibody
    • Transcobalamin1 antibody
    • TranscobalaminI antibody
    • Vitamin B12 binding protein antibody
    • Vitamin B12 binding protein R binder family antibody
    see all

Images


  • Immunocytochemistry/ Immunofluorescence of U2OS cells labelling TCN1 (blue) with ab202121.

  • All lanes : Anti-TCN1 antibody (ab202121) at 1/500 dilution

    Lane 1 : BT474 cell lysate
    Lane 2 : HT-29 cell lysate

    Predicted band size: 48 kDa

References

ab202121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up