Overview

  • Product name

  • Description

    Rabbit polyclonal to TCOF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TCOF1 aa 570-653.
    Sequence:

    KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSAD SEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS


    Database link: Q13428

  • Positive control

    • IHC-P: Human rectum tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as Treacher Collins syndrome protein

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in nucleolar-cytoplasmic transport. May play a fundamental role in early embryonic development, particularly in development of the craniofacial complex.
  • Involvement in disease

    Defects in TCOF1 are the cause of Treacher Collins syndrome type 1 (TCS1) [MIM:154500]. It is a form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss.
  • Sequence similarities

    Contains 1 LisH domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Mandibulofacial dysostosis antibody
    • MFD1 antibody
    • Nucleolar trafficking phosphoprotein antibody
    • TCOF 1 antibody
    • TCOF_HUMAN antibody
    • TCOF1 antibody
    • TCS antibody
    • TCS1 antibody
    • Treacher Collins Franceschetti syndrome 1 antibody
    • Treacher Collins syndrome antibody
    • Treacher Collins syndrome protein antibody
    • Treacle antibody
    • Treacle protein antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TCOF1 (green) using ab224544 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human rectum tissue stained for TCOF1 using ab224544 at 1/50 dilution in immunohistochemical analysis

References

ab224544 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up