Overview

  • Product name

  • Description

    Rabbit polyclonal to TCP1 eta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TCP1 eta aa 240-543.
    Sequence:

    LNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVV LSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSA DVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSL HDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYA KALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFE AFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGR GRPH


    Database link: Q99832-1

  • Positive control

    • WB: K562 and HEK-293 whole cell lysates. IHC-P: Human glioma tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 59 kDa.

Target

  • Function

    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities

    Belongs to the TCP-1 chaperonin family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCT ETA antibody
    • CCT-eta antibody
    • CCT7 antibody
    • CCTETA antibody
    • Ccth antibody
    • Chaperonin containing t complex polypeptide 1 eta subunit antibody
    • Chaperonin containing TCP1 subunit 7 (eta) antibody
    • Chaperonin containing TCP1 subunit 7 antibody
    • HIV 1 Nef interacting protein antibody
    • HIV-1 Nef-interacting protein antibody
    • Nip7 1 antibody
    • T complex protein 1 eta subunit antibody
    • T-complex protein 1 subunit eta, N-terminally processed antibody
    • TCP-1-eta antibody
    • TCP1eta antibody
    • TCPH_HUMAN antibody
    see all

Images

  • All lanes : Anti-TCP1 eta antibody (ab237762) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 59 kDa

  • Paraffin-embedded human glioma tissue stained for TCP1 eta with ab237762 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for TCP1 eta using ab237762 at 1/100 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab237762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up