Overview

  • Product name
  • Description
    Rabbit polyclonal to TCP11L2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human TCP11L2 aa 1-210.
    Sequence:

    MPFNGEKQCVGEDQPSDSDSSRFSESMASLSDYECSRQSFASDSSSKSSS PASTSPPRVVTFDEVMATARNLSNLTLAHEIAVNENFQLKQEALPEKSLA GRVKHIVHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNR LRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMGKLCAPVRDNDIRE LKATGNIVEV


    Database link: Q8N4U5

  • Positive control
    • WB: A549 whole cell lysate. IHC-P: Human small intestine and breast cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purity >95%
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities
    Belongs to the TCP11 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • E430026E19Rik antibody
    • MGC109402 antibody
    • MGC39016 antibody
    • MGC40368 antibody
    • RGD1307494 antibody
    • T complex 11 (mouse) like 2 antibody
    • T complex 11 like 2 antibody
    • T complex protein 11 like protein 2 antibody
    • T-complex protein 11-like protein 2 antibody
    • T11L2_HUMAN antibody
    • TCP11L2 antibody
    • TCP11L2 t complex 11 (mouse) like 2 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for TCP11L2 using ab235363 at 1/100 dilution in immunohistochemical analysis.

  • Anti-TCP11L2 antibody (ab235363) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human breast cancer tissue stained for TCP11L2 using ab235363 at 1/100 dilution in immunohistochemical analysis.

References

ab235363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up