Anti-TCPTP antibody (ab180764)
Key features and details
- Rabbit polyclonal to TCPTP
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-TCPTP antibody
See all TCPTP primary antibodies -
Description
Rabbit polyclonal to TCPTP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant full length protein corresponding to Human TCPTP aa 1-353. (Isoform 3)
Sequence:MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRD VSPYDHSRVKLQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLM VWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDV KSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVR ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN MRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSERPRL TDT
Database link: P17706-3 -
Positive control
- WB: Extracts of SW680, BT-474, Jurkat and K-562 cell lines; IHC: Rat heart tissue; ICC/ IF: MCF-7 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180764 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
1/50 - 1/200.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 41 kDa.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Notes |
---|
ICC/IF
1/50 - 1/200. |
WB
1/500 - 1/2000. Predicted molecular weight: 41 kDa. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
Tissue specificity
Isoform PTPA is probably the major isoform. Isoform PTPB is expressed in T-cells and in placenta. -
Sequence similarities
Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
Contains 1 tyrosine-protein phosphatase domain. -
Cellular localization
Cytoplasm; Nucleus and Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 5771 Human
- Entrez Gene: 117063 Rat
- Omim: 176887 Human
- SwissProt: P17706 Human
- SwissProt: P35233 Rat
- Unigene: 654527 Human
- Unigene: 663373 Human
- Unigene: 33497 Rat
-
Alternative names
- Protein tyrosine phosphatase non receptor type 2 antibody
- PTN2 antibody
- PTN2_HUMAN antibody
see all
Images
-
Paraffin-embedded rat heart tissue stained for TCPTP using ab180764 at 1/100 dilution in immunohistochemical analysis.
-
Immunofluorescence staining of MCF-7 cells stained for TCPTP with ab180764. Nuclei are labeled with DAPI (Blue).
-
All lanes : Anti-TCPTP antibody (ab180764) at 1/1000 dilution
Lane 1 : SW480 cell lysate
Lane 2 : BT-474 cell lysate
Lane 3 : Jurkat cell lysate
Lane 4 : K-562 cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 41 kDaBlocking buffer: 3% nonfat dry milk in TBST.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab180764 has been referenced in 5 publications.
- Debarba LK et al. The role of TCPTP on leptin effects on astrocyte morphology. Mol Cell Endocrinol 482:62-69 (2019). PubMed: 30572001
- Li Y et al. PTPN2 improved renal injury and fibrosis by suppressing STAT-induced inflammation in early diabetic nephropathy. J Cell Mol Med 23:4179-4195 (2019). PubMed: 30955247
- Wang YN et al. PTPN2 improves implant osseointegration in T2DM via inducing the dephosphorylation of ERK. Exp Biol Med (Maywood) 244:1493-1503 (2019). PubMed: 31615285
- Manguso RT et al. In vivo CRISPR screening identifies Ptpn2 as a cancer immunotherapy target. Nature 547:413-418 (2017). WB . PubMed: 28723893
- Bettaieb A et al. Hepatocyte Nicotinamide Adenine Dinucleotide Phosphate Reduced Oxidase 4 Regulates Stress Signaling, Fibrosis, and Insulin Sensitivity During Development of Steatohepatitis in Mice. Gastroenterology 149:468-80.e10 (2015). PubMed: 25888330