Anti-TCR V beta 3.1 antibody [8F10], prediluted (FITC) (ab171112)

Overview

  • Product name
    Anti-TCR V beta 3.1 antibody [8F10], prediluted (FITC)
    See all TCR V beta 3.1 primary antibodies
  • Description
    Mouse monoclonal [8F10] to TCR V beta 3.1, prediluted (FITC)
  • Host species
    Mouse
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: Blocking, ELISA, IP, ICC, IHC, Flow Cytmore details
  • Species reactivity
    Reacts with: Human, Non human primates
  • Immunogen

    Recombinant full length protein corresponding to Human TCR V beta 3.1 aa 1-133.
    Sequence:

    MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNR LYWYRQTLGQ GPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEI QRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL


    Database link: P04435

Properties

Applications

Our Abpromise guarantee covers the use of ab171112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Blocking Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
ICC Use at an assay dependent concentration.
IHC Use at an assay dependent concentration.
Flow Cyt Use a concentration of 200 µg/ml.

ab91356 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Flow cytometry analysis of TCR V beta 3.1 in PBMC cells compared to an isotype control (blue). Human blood was collected, combined with a hydrophilic polysaccharide, centrifuged, transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml, followed by the addition of 50 ul of isotype control and primary antibody (ab171112) at a dilution of 1:20. Cells were incubated for 30 min at 4ºC and washed with a cell buffer, followed by incubation with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4ºC in the dark. FACS analysis was performed using 400 ul of cell buffer.

References

ab171112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up