Overview

  • Product name

    Anti-TCR V beta 3.1 antibody
    See all TCR V beta 3.1 primary antibodies
  • Description

    Rabbit polyclonal to TCR V beta 3.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TCR V beta 3.1 aa 22-115.
    Sequence:

    GVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNE AQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSL


    Database link: P04435

  • Positive control

    • WB: HEK-293 whole cell lysate. IHC-P: Human pancreatic cancer and small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 13 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-TCR V beta 3.1 antibody (ab235044) at 1/500 dilution + HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for TCR V beta 3.1 using ab235044 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for TCR V beta 3.1 using ab235044 at 1/100 dilution in immunohistochemical analysis.

References

ab235044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up