Overview

  • Product name
    Anti-TCR V beta 5a antibody [1C1]
    See all TCR V beta 5a primary antibodies
  • Description
    Mouse monoclonal [1C1] to TCR V beta 5a
  • Host species
    Mouse
  • Tested applications
    Suitable for: Cellular Activation, Blocking, ICC, IHC, Flow Cyt, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Human, Non human primates
  • Immunogen

    Full length protein corresponding to Human TCR V beta 5a aa 1-133.
    Sequence:

    MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNR LYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQR TEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL


    Database link: P04435

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: PBS, 0.5% BSA
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    1C1
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Cellular Activation Use at an assay dependent concentration.

T-Cell activation

Blocking Use at an assay dependent concentration.
ICC Use at an assay dependent concentration.
IHC Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-Fr Use at an assay dependent concentration.

Target

  • Database links
  • Alternative names
    • T cell receptor beta locus antibody
    • T-cell antigen receptor, beta polypeptide, T-cell receptor, beta cluster antibody
    • T-cell receptor beta chain V region CTL-L17 antibody
    • T-cell receptor, beta cluster antibody
    • TCRB antibody
    • TRB antibody
    • TRB@ antibody
    see all

References

ab171111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up