Anti-TCTA antibody (ab235781)
Key features and details
- Rabbit polyclonal to TCTA
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TCTA antibody
See all TCTA primary antibodies -
Description
Rabbit polyclonal to TCTA -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human TCTA aa 62-103.
Sequence:NTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Database link: P57738 -
Positive control
- WB: Mouse liver, gonadal and muscle tissue lysate; HL-60, U-251 MG and MCF7 whole cell lysate. IHC-P: Human adrenal gland and colon cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235781 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
May be required for cellular fusion during osteoclastogenesis. -
Tissue specificity
Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level). -
Involvement in disease
A chromosomal aberration involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(1;3)(p34;p21). -
Sequence similarities
Belongs to the TCTA family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6988 Human
- Entrez Gene: 102791 Mouse
- Entrez Gene: 306587 Rat
- Omim: 600690 Human
- SwissProt: P57738 Human
- SwissProt: Q8VEA7 Mouse
- SwissProt: Q5XIF1 Rat
- Unigene: 517962 Human
-
Alternative names
- T-cell leukemia translocation altered gene antibody
- T-cell leukemia translocation-altered gene protein antibody
- T-cell leukemia translocation-associated gene protein antibody
see all
Images
-
All lanes : Anti-TCTA antibody (ab235781) at 1/1000 dilution
Lane 1 : Mouse liver tissue lysate
Lane 2 : Mouse gonadal tissue lysate
Lane 3 : Mouse muscle tissue lysate
Lane 4 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
Lane 5 : U-251 MG (human brain glioma cell line) whole cell lysate
Lane 6 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCTA antibody (ab235781)
Paraffin-embedded human adrenal gland tissue stained for TCTA using ab235781 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TCTA antibody (ab235781)
Paraffin-embedded human colon cancer tissue stained for TCTA using ab235781 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235781 has not yet been referenced specifically in any publications.