Anti-TDG antibody (ab238330)
Key features and details
- Rabbit polyclonal to TDG
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TDG antibody
See all TDG primary antibodies -
Description
Rabbit polyclonal to TDG -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human TDG aa 141-410.
Sequence:PGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFT NMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYI KLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEA AYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTD QIPSFSNHCGTQEQEEESHA
Database link: Q13569 -
Positive control
- IHC-P: Human colon cancer and heart tissue.
-
General notes
Previously labelled as Thymine DNA glycosylase.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238330 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. -
Sequence similarities
Belongs to the TDG/mug DNA glycosylase family. -
Post-translational
modificationsSumoylation on Lys-330 by either SUMO1 or SUMO2 induces dissociation of the product DNA. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6996 Human
- Entrez Gene: 21665 Mouse
- Omim: 601423 Human
- SwissProt: Q13569 Human
- SwissProt: P56581 Mouse
- Unigene: 584809 Human
- Unigene: 284252 Mouse
- Unigene: 347607 Mouse
-
Alternative names
- C JUN leucine zipper interactive protein antibody
- C JUN leucine zipper interactive protein antibody
- C-JUN leucine zipper interactive protein JZA-3 antibody
see all
Images
-
Paraffin-embedded human heart tissue stained for TDG with ab238330 at a 1/100 dilution in immunohistochemical analysis.
-
Paraffin-embedded human colon cancer tissue stained for TDG with ab238330 at a 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab238330 has not yet been referenced specifically in any publications.