Anti-TDG antibody (ab238330)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TDG antibody
See all TDG primary antibodies -
Description
Rabbit polyclonal to TDG -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human TDG aa 141-410.
Sequence:PGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFT NMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYI KLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEA AYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTD QIPSFSNHCGTQEQEEESHA
Database link: Q13569 -
Positive control
- IHC-P: Human colon cancer and heart tissue.
-
General notes
Previously labelled as Thymine DNA glycosylase.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238330 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
In the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. -
Sequence similarities
Belongs to the TDG/mug DNA glycosylase family. -
Post-translational
modificationsSumoylation on Lys-330 by either SUMO1 or SUMO2 induces dissociation of the product DNA. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6996 Human
- Entrez Gene: 21665 Mouse
- Omim: 601423 Human
- SwissProt: Q13569 Human
- SwissProt: P56581 Mouse
- Unigene: 584809 Human
- Unigene: 284252 Mouse
- Unigene: 347607 Mouse
-
Alternative names
- C JUN leucine zipper interactive protein antibody
- C JUN leucine zipper interactive protein antibody
- C-JUN leucine zipper interactive protein JZA-3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDG antibody (ab238330)Paraffin-embedded human heart tissue stained for TDG with ab238330 at a 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDG antibody (ab238330)Paraffin-embedded human colon cancer tissue stained for TDG with ab238330 at a 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab238330 has not yet been referenced specifically in any publications.
