Overview

  • Product name

  • Description

    Rabbit polyclonal to TDH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human TDH aa 1-229. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    MLFIRMLRRAGQSPACGCWTPVLPVRFLGISPRQIPADANFHSASFSDTD HPRVLITGALGQLGVGLANLLRKRFGKDSVILSDIRKPPDHVFHSGPFIY SDILDYKNLREIVVNNRITWLFHYSALLSAFGEANVSLARAVNITGLHNI LDVAAEHNLQLFVPSTIGAFGPTSPRNPTPDLCIQRPRTIYGVSKVHAEL MGETMQSRFSMMPQSMANSSATWKPARDC


    Database link: Q8IZJ6

  • Positive control

    • IHC-P: Human liver, cerebrum and glioma tissue. WB: Recombinant human TDH protein; Pig liver and kidney lysates; HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    TDH (L threonine dehydrogenase) belongs to the sugar epimerase family and catalyzes the first of two steps in one of two L-threonine degradation pathways. According to reports, the human TDH gene is an expressed pseudogene encoding non-functional truncated proteins that are unable to make appropriate contacts with the substrates, L-threonine and NAD+.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • FLJ25033 antibody
    • Inactive L threonine 3 dehydrogenase mitochondrial antibody
    • L threonine dehydrogenase antibody
    • SDR14E1P antibody

Images

  • All lanes : Anti-TDH antibody (ab233402) at 1 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : Pig kidney tissue lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 25 kDa

  • Anti-TDH antibody (ab233402) at 1 µg/ml + Recombinant human TDH protein.

    Predicted band size: 25 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for TDH using ab233402 at 30µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for TDH using ab233402 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for TDH using ab233402 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab233402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up