Overview

  • Product name

    Anti-TDP2 antibody [TDP2/1258]
  • Description

    Mouse monoclonal [TDP2/1258] to TDP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TDP2 aa 1-362.
    Sequence:

    MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL


    Database link: O95551

  • Positive control

    • IHC-P: Human lung carcinoma, prostate carcinoma, duodenal carcinoma and colon carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab218476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Primary incubation is for 30 min at RT.

Target

  • Function

    DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. May also act as a negative regulator of ETS1 and may inhibit nuclear factor-kappa-B activation.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the CCR4/nocturin family.
  • Cellular localization

    Nucleus. Nucleus > PML body.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5'-Tyr-DNA phosphodiesterase antibody
    • 5'-tyrosyl-DNA phosphodiesterase antibody
    • AD 022 antibody
    • AD022 antibody
    • dJ30M3.3 antibody
    • EAP 2 antibody
    • EAP II antibody
    • EAP2 antibody
    • EAPII antibody
    • ETS 1 associated protein 2 antibody
    • ETS 1 associated protein II antibody
    • ETS1 associated protein 2 antibody
    • ETS1 associated protein II antibody
    • ETS1-associated protein 2 antibody
    • ETS1-associated protein II antibody
    • MGC111021 antibody
    • MGC9099 antibody
    • RP1-30M3.3 antibody
    • tdp2 antibody
    • TRAF and TNF receptor associated protein antibody
    • TRAF and TNF receptor-associated protein antibody
    • TTRAP antibody
    • TYDP2_HUMAN antibody
    • Tyr DNA phosphodiesterase 2 antibody
    • Tyr-DNA phosphodiesterase 2 antibody
    • Tyrosyl DNA phosphodiesterase 2 antibody
    • Tyrosyl-DNA phosphodiesterase 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue section labeling TDP2 with ab218476 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate carcinoma tissue section labeling TDP2 with ab218476 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human duodenal carcinoma tissue section labeling TDP2 with ab218476 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue section labeling TDP2 with ab218476 at 1 µg/ml.

References

ab218476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up