Anti-TDP43 antibody [2E2-D3] (ab57105)

Submit a review Q&A (1)References (13)

Overview

  • Product name
    Anti-TDP43 antibody [2E2-D3]
    See all TDP43 primary antibodies
  • Description
    Mouse monoclonal [2E2-D3] to TDP43
  • Host species
    Mouse
  • Tested applications
    Suitable for: Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human TDP43 aa 1-261. The molecular weight of GST-tag is 26kDa.
    Sequence:

    MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC MRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTE DMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLII KGISVHISNA


    Database link: Q13148

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

Properties

Applications

Our Abpromise guarantee covers the use of ab57105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1-2µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 
WB Use a concentration of 1 - 5 µg/ml.
ICC/IF Use a concentration of 10 µg/ml.
IHC-P Use a concentration of 5 µg/ml.
Sandwich ELISA Use at an assay dependent concentration.

Target

  • Function
    DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
  • Tissue specificity
    Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
  • Involvement in disease
    Defects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
  • Sequence similarities
    Contains 2 RRM (RNA recognition motif) domains.
  • Domain
    The RRM domains can bind to both DNA and RNA.
  • Post-translational
    modifications
    Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
  • Cellular localization
    Nucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
  • Information by UniProt
  • Database links
    • Alternative names
      • ALS10 antibody
      • OTTHUMP00000002171 antibody
      • OTTHUMP00000002172 antibody
      • OTTHUMP00000002173 antibody
      • TADBP_HUMAN antibody
      • TAR DNA binding protein 43 antibody
      • TAR DNA binding protein antibody
      • TAR DNA-binding protein 43 antibody
      • TARDBP antibody
      • TDP 43 antibody
      • TDP-43 antibody
      • TDP43 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 in human leiomyosarcoma tissue. Antibody concentration 3µg/ml.

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

      TDP43 antibody (ab57105) at 1ug/lane + A-431 cell lysate at 25ug/lane.

    • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 in HeLa cells. Antibody concentration 10µg/ml.

       

       

    • Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)

      Detection limit for recombinant GST tagged TDP43 is 0.3 ng/ml as a capture antibody.

       

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 overexpressed in the HEK293 cell line (cotransfected with TDP43 validated Chimera siRNA) (lane 1) or non-tranfected control (lane 2).

      GAPDH used as a specificity and loading control.

    • Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Overlay histogram showing HeLa cells stained with ab57105 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57105, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      All lanes : Anti-TDP43 antibody [2E2-D3] (ab57105) at 5 µg/ml

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with TDP43, cell lysate
      Lane 2 : Untransfected HEK-293T cell lysate

      Developed using the ECL technique.
    • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
      TARDBP antibody (ab57105) used in immunofluorescence at 10ug/ml on HeLa cells.

    References

    This product has been referenced in:
    • Taylor LM  et al. Pathological phosphorylation of tau and TDP-43 by TTBK1 and TTBK2 drives neurodegeneration. Mol Neurodegener 13:7 (2018). WB ; Caenorhabditis elegans . Read more (PubMed: 29409526) »
    • Chandran JS  et al. Site Specific Modification of Adeno-Associated Virus Enables Both Fluorescent Imaging of Viral Particles and Characterization of the Capsid Interactome. Sci Rep 7:14766 (2017). Read more (PubMed: 29116194) »
    See all 13 Publications for this product

    Publishing research using ab57105? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    I am interested in using this antibody with mouse samples in WB. Is there a testing discount available?

    Read More
    Answer

    I am very pleased to hear you would like to accept our offer and test ab57105 in mouse in WB. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for mouse in WB and include this code in the Additional Comments section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.


    Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

    Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

    The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up