Anti-TDP43 antibody [2E2-D3] (ab57105)
Key features and details
- Mouse monoclonal [2E2-D3] to TDP43
- Suitable for: Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISA
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-TDP43 antibody [2E2-D3]
See all TDP43 primary antibodies -
Description
Mouse monoclonal [2E2-D3] to TDP43 -
Host species
Mouse -
Tested Applications & Species
Application Species Flow Cyt HumanICC/IF HumanIHC-P HumansELISA Recombinant fragmentWB Human -
Immunogen
Recombinant full length protein (GST-tag) corresponding to Human TDP43 aa 1-261. The molecular weight of GST-tag is 26kDa.
Sequence:MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC MRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTE DMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLII KGISVHISNA
Database link: Q13148 -
General notes
This product was changed from ascites to tissue culture supernatant on 5/3/19. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
2E2-D3 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab57105 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
Flow Cyt |
Human
|
ICC/IF |
Human
|
IHC-P |
Human
|
sELISA |
Recombinant fragment
|
WB |
Human
|
Application | Abreviews | Notes |
---|---|---|
Flow Cyt |
Use at an assay dependent concentration.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
|
WB | (1) |
Use at an assay dependent concentration.
|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
Use at an assay dependent concentration.
|
|
Sandwich ELISA |
Use at an assay dependent concentration.
|
Notes |
---|
Flow Cyt
Use at an assay dependent concentration. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
WB
Use at an assay dependent concentration. |
ICC/IF
Use at an assay dependent concentration. |
IHC-P
Use at an assay dependent concentration. |
Sandwich ELISA
Use at an assay dependent concentration. |
Target
-
Function
DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR. -
Tissue specificity
Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen. -
Involvement in disease
Defects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. -
Sequence similarities
Contains 2 RRM (RNA recognition motif) domains. -
Domain
The RRM domains can bind to both DNA and RNA. -
Post-translational
modificationsHyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU. -
Cellular localization
Nucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies. - Information by UniProt
-
Database links
- Entrez Gene: 23435 Human
- Omim: 605078 Human
- SwissProt: Q13148 Human
- Unigene: 300624 Human
- Unigene: 635053 Human
-
Alternative names
- ALS10 antibody
- OTTHUMP00000002171 antibody
- OTTHUMP00000002172 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)
ab57105 staining TDP43 in human leiomyosarcoma tissue. Antibody concentration 3µg/ml.
This image was generated using the ascites version of the product.
-
TDP43 antibody (ab57105) at 1ug/lane + A-431 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
ab57105 staining TDP43 in HeLa cells. Antibody concentration 10µg/ml.
This image was generated using the ascites version of the product.
-
Detection limit for recombinant GST tagged TDP43 is 0.3 ng/ml as a capture antibody.
This image was generated using the ascites version of the product.
-
ab57105 staining TDP43 overexpressed in the HEK293 cell line (cotransfected with TDP43 validated Chimera siRNA) (lane 1) or non-tranfected control (lane 2).
GAPDH used as a specificity and loading control.
This image was generated using the ascites version of the product.
-
Overlay histogram showing HeLa cells stained with ab57105 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57105, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
This image was generated using the ascites version of the product. -
All lanes : Anti-TDP43 antibody [2E2-D3] (ab57105) at 5 µg/ml
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with TDP43, cell lysate
Lane 2 : Untransfected HEK-293T cell lysate
Developed using the ECL technique.This image was generated using the ascites version of the product.
-
TARDBP antibody (ab57105) used in immunofluorescence at 10ug/ml on HeLa cells.
This image was generated using the ascites version of the product.
Protocols
References (18)
ab57105 has been referenced in 18 publications.
- Rossor AM et al. TDP43 pathology in the brain, spinal cord, and dorsal root ganglia of a patient with FOSMN. Neurology 92:e951-e956 (2019). PubMed: 30700593
- Donde A et al. Splicing repression is a major function of TDP-43 in motor neurons. Acta Neuropathol 138:813-826 (2019). PubMed: 31332509
- Latimer CS et al. Resistance and resilience to Alzheimer's disease pathology are associated with reduced cortical pTau and absence of limbic-predominant age-related TDP-43 encephalopathy in a community-based cohort. Acta Neuropathol Commun 7:91 (2019). PubMed: 31174609
- Liachko NF et al. Genome wide analysis reveals heparan sulfate epimerase modulates TDP-43 proteinopathy. PLoS Genet 15:e1008526 (2019). PubMed: 31834878
- Taylor LM et al. Pathological phosphorylation of tau and TDP-43 by TTBK1 and TTBK2 drives neurodegeneration. Mol Neurodegener 13:7 (2018). WB ; Caenorhabditis elegans . PubMed: 29409526