Name: Anti-TDP43 antibody [2E2-D3]
SKU: ab57105
Rating: 1 (1 reviews)

Add a compatible secondary antibody

Primary

Secondary

This product Mouse Anti-TDP43 antibody [2E2-D3] (ab57105)
Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISA

Goat Anti-Mouse IgG H&L (HRP) (ab205719)
WB, IP, ELISA, IHC-P

The primary selected is not available to customers in this country.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

Product name

Anti-TDP43 antibody [2E2-D3]
See all TDP43 primary antibodies
Description

Mouse monoclonal [2E2-D3] to TDP43
Host species

Mouse
Tested applications

Suitable for: Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISAmore details
Species reactivity

Reacts with: Human
Immunogen

Recombinant full length protein (GST-tag) corresponding to Human TDP43 aa 1-261. The molecular weight of GST-tag is 26kDa.
Sequence:
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC MRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTE DMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLII KGISVHISNA

Database link: Q13148

Run BLAST with Run BLAST with
General notes

This product was changed from ascites to tissue culture supernatant on 5/3/19. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Form

Liquid
Storage instructions

Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Storage buffer

Preservative: None
PBS, pH 7.2
Purity

Tissue culture supernatant
Clonality

Monoclonal
Clone number

2E2-D3
Isotype

IgG1
Light chain type

kappa
Research areas

Compatible Secondaries
Isotype control
- Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
- Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
Recombinant Protein
- Recombinant Human TDP43 protein (denatured) (ab156345)

Our Abpromise guarantee covers the use of ab57105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
Flow Cyt		Use at an assay dependent concentration. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
WB		Use at an assay dependent concentration.
ICC/IF		Use at an assay dependent concentration.
IHC-P		Use at an assay dependent concentration.
Sandwich ELISA		Use at an assay dependent concentration.

Function

DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
Tissue specificity

Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
Involvement in disease

Defects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
Sequence similarities

Contains 2 RRM (RNA recognition motif) domains.
Domain

The RRM domains can bind to both DNA and RNA.
Post-translational
modifications

Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
Cellular localization

Nucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
Target information above from: UniProt accession Q13148 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 23435 Human
- Omim: 605078 Human
- SwissProt: Q13148 Human
- Unigene: 300624 Human
- Unigene: 635053 Human
Alternative names
- ALS10 antibody
- OTTHUMP00000002171 antibody
- OTTHUMP00000002172 antibody
- OTTHUMP00000002173 antibody
- TADBP_HUMAN antibody
- TAR DNA binding protein 43 antibody
- TAR DNA binding protein antibody
- TAR DNA-binding protein 43 antibody
- TARDBP antibody
- TDP 43 antibody
- TDP-43 antibody
- TDP43 antibody
see all

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)

ab57105 staining TDP43 in human leiomyosarcoma tissue. Antibody concentration 3µg/ml.

This image was generated using the ascites version of the product.
Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

TDP43 antibody (ab57105) at 1ug/lane + A-431 cell lysate at 25ug/lane.

This image was generated using the ascites version of the product.
Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

ab57105 staining TDP43 in HeLa cells. Antibody concentration 10µg/ml.

This image was generated using the ascites version of the product.
Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)

Detection limit for recombinant GST tagged TDP43 is 0.3 ng/ml as a capture antibody.

This image was generated using the ascites version of the product.
Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

ab57105 staining TDP43 overexpressed in the HEK293 cell line (cotransfected with TDP43 validated Chimera siRNA) (lane 1) or non-tranfected control (lane 2).

GAPDH used as a specificity and loading control.

This image was generated using the ascites version of the product.
Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)

Overlay histogram showing HeLa cells stained with ab57105 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57105, 1µg/1x10⁶ cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x10⁶ cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
This image was generated using the ascites version of the product.
Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

All lanes : Anti-TDP43 antibody [2E2-D3] (ab57105) at 5 µg/ml

Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with TDP43, cell lysate
Lane 2 : Untransfected HEK-293T cell lysate

Developed using the ECL technique.

This image was generated using the ascites version of the product.
Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

TARDBP antibody (ab57105) used in immunofluorescence at 10ug/ml on HeLa cells.

This image was generated using the ascites version of the product.

Flow cytometry protocols
Immunohistochemistry protocols
Immunocytochemistry & immunofluorescence protocols
Western blot protocols

This product has been referenced in:

Rossor AM et al. TDP43 pathology in the brain, spinal cord, and dorsal root ganglia of a patient with FOSMN. Neurology 92:e951-e956 (2019). Read more (PubMed: 30700593) »
Taylor LM et al. Pathological phosphorylation of tau and TDP-43 by TTBK1 and TTBK2 drives neurodegeneration. Mol Neurodegener 13:7 (2018). WB ; Caenorhabditis elegans . Read more (PubMed: 29409526) »

See all 15 Publications for this product

Publishing research using ab57105? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A

Submit a review Submit a question

1-2 of 2 Abreviews or Q&A

Application

Western blot

Sample

Mouse Cell lysate - whole cell (myoblase and C2C12)

Gel Running Conditions

Reduced Denaturing (10%)

Loading amount

3 µg

Specification

myoblase and C2C12

Blocking step

Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. wei xia

Verified customer

Submitted Feb 25 2019

Question

I am interested in using this antibody with mouse samples in WB. Is there a testing discount available?

Abcam community

Verified customer

Asked on Jan 17 2012

Answer

I am very pleased to hear you would like to accept our offer and test ab57105 in mouse in WB. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for mouse in WB and include this code in the Additional Comments section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Abcam Scientific Support

Answered on Jan 17 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Location selector

Your location is currently set to:

Custom solutions & partnerships

Anti-TDP43 antibody [2E2-D3] (ab57105)

Overview

Properties

Associated products

Applications

Target

Images

Protocols

Datasheets and documents

References

This product has been referenced in:

Customer reviews and Q&As

Western blot abreview for Anti-TDP43 antibody [2E2-D3]