For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tdp43-antibody-2e2-d3-ab57105.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Organism Virus RNA Virus ssRNA positive strand virus HIV
Share by email

Anti-TDP43 antibody [2E2-D3] (ab57105)

  • Datasheet
  • SDS
Reviews (1)Q&A (1)References (18)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
  • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

Key features and details

  • Mouse monoclonal [2E2-D3] to TDP43
  • Suitable for: Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISA
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Primary
Product image
Anti-TDP43 antibody [EPR5811] (ab133547)
Protein
Product image
Recombinant Human TDP43 protein (denatured) (ab156345)
Primary
Product image
Anti-TCR beta F1 antibody [8A3] (ab171088)

View more associated products

Overview

  • Product name

    Anti-TDP43 antibody [2E2-D3]
    See all TDP43 primary antibodies
  • Description

    Mouse monoclonal [2E2-D3] to TDP43
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    sELISA
    Recombinant fragment
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human TDP43 aa 1-261. The molecular weight of GST-tag is 26kDa.
    Sequence:

    MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC MRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTE DMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLII KGISVHISNA


    Database link: Q13148
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    This product was changed from ascites to tissue culture supernatant on 5/3/19. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    2E2-D3
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Microbiology
    • Organism
    • Virus
    • RNA Virus
    • ssRNA positive strand virus
    • HIV
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Amyotrophic lateral sclerosis
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Splicing
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Other
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Other factors

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Mouse IgG1, Kappa Monoclonal [B11/6] - Isotype Control (ab91353)
  • Recombinant Protein

    • Recombinant Human TDP43 protein (denatured) (ab156345)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab57105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
Flow Cyt
Human
ICC/IF
Human
IHC-P
Human
sELISA
Recombinant fragment
WB
Human
Application Abreviews Notes
Flow Cyt
Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

WB (1)
Use at an assay dependent concentration.
ICC/IF
Use at an assay dependent concentration.
IHC-P
Use at an assay dependent concentration.
Sandwich ELISA
Use at an assay dependent concentration.
Notes
Flow Cyt
Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

WB
Use at an assay dependent concentration.
ICC/IF
Use at an assay dependent concentration.
IHC-P
Use at an assay dependent concentration.
Sandwich ELISA
Use at an assay dependent concentration.

Target

  • Function

    DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
  • Tissue specificity

    Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
  • Involvement in disease

    Defects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
  • Sequence similarities

    Contains 2 RRM (RNA recognition motif) domains.
  • Domain

    The RRM domains can bind to both DNA and RNA.
  • Post-translational
    modifications

    Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
  • Cellular localization

    Nucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
  • Target information above from: UniProt accession Q13148 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 23435 Human
    • Omim: 605078 Human
    • SwissProt: Q13148 Human
    • Unigene: 300624 Human
    • Unigene: 635053 Human
    • Alternative names

      • ALS10 antibody
      • OTTHUMP00000002171 antibody
      • OTTHUMP00000002172 antibody
      • OTTHUMP00000002173 antibody
      • TADBP_HUMAN antibody
      • TAR DNA binding protein 43 antibody
      • TAR DNA binding protein antibody
      • TAR DNA-binding protein 43 antibody
      • TARDBP antibody
      • TDP 43 antibody
      • TDP-43 antibody
      • TDP43 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 in human leiomyosarcoma tissue. Antibody concentration 3µg/ml.

      This image was generated using the ascites version of the product.

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

      TDP43 antibody (ab57105) at 1ug/lane + A-431 cell lysate at 25ug/lane.

      This image was generated using the ascites version of the product.

    • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 in HeLa cells. Antibody concentration 10µg/ml.

      This image was generated using the ascites version of the product.

       

       

    • Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)

      Detection limit for recombinant GST tagged TDP43 is 0.3 ng/ml as a capture antibody.

      This image was generated using the ascites version of the product.

       

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

      ab57105 staining TDP43 overexpressed in the HEK293 cell line (cotransfected with TDP43 validated Chimera siRNA) (lane 1) or non-tranfected control (lane 2).

      GAPDH used as a specificity and loading control.

      This image was generated using the ascites version of the product.

    • Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)

      Overlay histogram showing HeLa cells stained with ab57105 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57105, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
      This image was generated using the ascites version of the product.

    • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
      All lanes : Anti-TDP43 antibody [2E2-D3] (ab57105) at 5 µg/ml

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with TDP43, cell lysate
      Lane 2 : Untransfected HEK-293T cell lysate

      Developed using the ECL technique.


      This image was generated using the ascites version of the product.

    • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
      Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

      TARDBP antibody (ab57105) used in immunofluorescence at 10ug/ml on HeLa cells.

      This image was generated using the ascites version of the product.

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (18)

    Publishing research using ab57105? Please let us know so that we can cite the reference in this datasheet.

    ab57105 has been referenced in 18 publications.

    • Rossor AM  et al. TDP43 pathology in the brain, spinal cord, and dorsal root ganglia of a patient with FOSMN. Neurology 92:e951-e956 (2019). PubMed: 30700593
    • Donde A  et al. Splicing repression is a major function of TDP-43 in motor neurons. Acta Neuropathol 138:813-826 (2019). PubMed: 31332509
    • Latimer CS  et al. Resistance and resilience to Alzheimer's disease pathology are associated with reduced cortical pTau and absence of limbic-predominant age-related TDP-43 encephalopathy in a community-based cohort. Acta Neuropathol Commun 7:91 (2019). PubMed: 31174609
    • Liachko NF  et al. Genome wide analysis reveals heparan sulfate epimerase modulates TDP-43 proteinopathy. PLoS Genet 15:e1008526 (2019). PubMed: 31834878
    • Taylor LM  et al. Pathological phosphorylation of tau and TDP-43 by TTBK1 and TTBK2 drives neurodegeneration. Mol Neurodegener 13:7 (2018). WB ; Caenorhabditis elegans . PubMed: 29409526
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Western blot abreview for Anti-TDP43 antibody [2E2-D3]

    Poor
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Cell lysate - whole cell (myoblase and C2C12)
    Gel Running Conditions
    Reduced Denaturing (10%)
    Loading amount
    3 µg
    Specification
    myoblase and C2C12
    Blocking step
    Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Dr. wei xia

    Verified customer

    Submitted Feb 25 2019

    Question

    I am interested in using this antibody with mouse samples in WB. Is there a testing discount available?

    Read More

    Abcam community

    Verified customer

    Asked on Jan 17 2012

    Answer

    I am very pleased to hear you would like to accept our offer and test ab57105 in mouse in WB. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for mouse in WB and include this code in the Additional Comments section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.


    Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

    Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

    The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on Jan 17 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.