Overview

  • Product name

  • Description

    Rabbit polyclonal to TDRD7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TDRD7 aa 796-905.
    Sequence:

    LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNADLWKHQ KDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSA FSTEELPPPV


    Database link: Q8NHU6

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Contains 2 Tudor domains.
  • Cellular localization

    Cytoplasm. Present in chromatoid body (CB) of spermatids (mammalian counterpart of germplasm, pole plasm or polar granules in Drosophila germ cells), also named processing bodies (P-bodies) in somatic cells. Detected in the multilobular cytoplasmic CBs (also called intermitochondrial cementin) in pachytene spermatocytes and as a single perinuclear CB in haploid round spermatids.
  • Information by UniProt
  • Database links

  • Form

    Found in a mRNP complex, at least composed of TDRD1, TDRD6, TDRD7 and DDX4. Found in a complex containing CABLES1, CDK16 and CDK17. Interacts with CABLES1, CDK17 and PIWIL1.
  • Alternative names

    • CATC4 antibody
    • KIAA1529 antibody
    • PCTAIRE 2 antibody
    • PCTAIRE2 binding protein antibody
    • PCTAIRE2 BP antibody
    • PCTAIRE2-binding protein antibody
    • PCTAIRE2BP antibody
    • RP11-508D10.1 antibody
    • TDRD 7 antibody
    • Tdrd7 antibody
    • TDRD7_HUMAN antibody
    • TrAP antibody
    • Tudor domain containing 7 antibody
    • Tudor domain-containing protein 7 antibody
    • Tudor repeat associator with PCTAIRE 2 antibody
    see all

Images

  • Paraffin embedded human testis tissue stained for TDRD7 with ab224462 (1/500 dilution) in immunohistochemical analysis.

References

ab224462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up