Overview

  • Product name

  • Description

    Mouse polyclonal to TDU
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human TDU aa 1-258.
    Sequence:

    MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALS NIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAA NCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPF PARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTG LLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH PHRYLQHL


    Database link: NP_057351.1

  • Positive control

    • Human placenta lysate; TDU transfected 293T cell lysate; HeLa cells.
  • General notes

     This product was previously labelled as VGLL1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    May act as a specific coactivator for the mammalian TEFs.
  • Sequence similarities

    Belongs to the vestigial family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein TONDU antibody
    • TDU antibody
    • TONDU antibody
    • Transcription cofactor vestigial like protein 1 antibody
    • Transcription cofactor vestigial-like protein 1 antibody
    • Vestigial like 1 antibody
    • vestigial like 1 homolog (Drosophila) antibody
    • Vgl-1 antibody
    • VGL1 antibody
    • Vgll1 antibody
    • VGLL1_HUMAN antibody
    see all

Images

  • Anti-TDU antibody (ab169163) at 1 µg/ml + Human placenta tissue lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 29 kDa

  • All lanes : Anti-TDU antibody (ab169163) at 1 µg/ml

    Lane 1 : TDU-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 29 kDa

  • Immunofluorescent analysis of HeLa cells labeling TDU with ab169163 at 10µg/ml.

References

ab169163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up