Overview

  • Product name

  • Description

    Rabbit polyclonal to TEAD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TEAD3 aa 112-435.
    Sequence:

    MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRF WSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAAS VPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDP PLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGP GAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYR IHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLV IAFVFEVSTSEHGAQHHVYKLVKD


    Database link: Q99594

  • Positive control

    • IHC-P: Human colon cancer and pancreatic cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab237766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer.
  • Tissue specificity

    Preferentially expressed in the placenta.
  • Sequence similarities

    Contains 1 TEA DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DTEF 1 antibody
    • DTEF-1 antibody
    • DTEF1 antibody
    • ETFR 1 antibody
    • ETFR1 antibody
    • TEA domain family member 3 antibody
    • TEA domain family member 5 antibody
    • TEAD 3 antibody
    • TEAD-3 antibody
    • Tead3 antibody
    • TEAD3_HUMAN antibody
    • TEAD5 antibody
    • TEF 5 antibody
    • TEF5 antibody
    • Transcriptional enhancer factor 5 antibody
    • Transcriptional enhancer factor TEF 5 (DTEF 1) antibody
    • Transcriptional enhancer factor TEF 5 antibody
    • Transcriptional enhancer factor TEF-5 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for TEAD3 with ab237766 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human pancreatic cancer tissue stained for TEAD3 with ab237766 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab237766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up