Overview

  • Product name

    Anti-TELO2 antibody - C-terminal
    See all TELO2 primary antibodies
  • Description

    Rabbit polyclonal to TELO2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide within Human TELO2 aa 787-836 (C terminal). The exact sequence is proprietary.
    Sequence:

    LEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPAS


    Database link: Q9Y4R8

  • Positive control

    • HepG2 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab182525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 92 kDa.

Target

  • Function

    May be involved in telomere length regulation. Promotes assembly, stabilizes and maintains the activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals.
  • Sequence similarities

    Belongs to the TEL2 family.
  • Cellular localization

    Cytoplasm. Membrane. Nucleus. Chromosome > telomere.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLK2 antibody
    • hCLK2 antibody
    • KIAA0683 antibody
    • Protein clk-2 homolog antibody
    • TEL2 antibody
    • TEL2 telomere maintenance 2 homolog antibody
    • TEL2, telomere maintenance 2, homolog antibody
    • telo2 antibody
    • TELO2_HUMAN antibody
    • Telomere length regulation protein TEL2 homolog antibody
    • Telomere maintenance 2 antibody
    see all

Images

  • Anti-TELO2 antibody - C-terminal (ab182525) at 1 µg/ml + HepG2 whole cell lysates at 10 µg

    Predicted band size: 92 kDa

References

ab182525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up