Anti-Telomerase reverse transcriptase antibody (ab230527)

Rabbit polyclonal Telomerase reverse transcriptase antibody. Validated in WB, IHC, Flow Cyt, ICC/IF and tested in Human. Immunogen corresponding to synthetic peptide.

Overview

  • Product name

    Anti-Telomerase reverse transcriptase antibody
    See all Telomerase reverse transcriptase primary antibodies
  • Description

    Rabbit polyclonal to Telomerase reverse transcriptase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Telomerase reverse transcriptase aa 627-656 conjugated to keyhole limpet haemocyanin.
    Sequence:

    PDGLRPIVNMDYVVGARTFRREKRAERLTS


    Database link: O14746

  • Positive control

    • WB: Jurkat whole cell lysate (ab7899). IHC-P: Human skin tissue. ICC/IF: SH-SY5Y and HeLa cells. Flow cytometry: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 127 kDa.
ICC/IF 1/10 - 1/50.
Flow Cyt 1/10 - 1/50.
IHC-P 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis.
  • Tissue specificity

    Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T lymphocytes, and at a low to undetectable level in peripheral blood T lymphocytes.
  • Involvement in disease

    Note=Activation of telomerase has been implicated in cell immortalization and cancer cell pathogenesis.
    Defects in TERT are associated with susceptibilty to aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
    Note=Genetic variations in TERT are associated with coronary artery disease (CAD).
    Defects in TERT are a cause of dyskeratosis congenita autosomal dominant (ADDKC) [MIM:127550]; also known as dyskeratosis congenita Scoggins type. ADDKC is a rare, progressive bone marrow failure syndrome characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.
    Defects in TERT are a cause of susceptibility to pulmonary fibrosis idiopathic (IPF) [MIM:178500]. Pulmonary fibrosis is a lung disease characterized by shortness of breath, radiographically evident diffuse pulmonary infiltrates, and varying degrees of inflammation and fibrosis on biopsy. It results in acute lung injury with subsequent scarring and endstage lung disease.
  • Sequence similarities

    Belongs to the reverse transcriptase family. Telomerase subfamily.
    Contains 1 reverse transcriptase domain.
  • Domain

    The primer grip sequence in the RT domain is required for telomerase activity and for stable association with short telomeric primers.
    The RNA-interacting domain 1 (RD1)/N-terminal extension (NTE) is required for interaction with the pseudoknot-template domain of each of TERC dimers. It contains anchor sites that bind primer nucleotides upstream of the RNA-DNA hybrid and is thus an essential determinant of repeat addition processivity.
    The RNA-interacting domain 2 (RD2) is essential for both interaction with the CR4-CR5 domain of TERC and for DNA sythesis.
  • Post-translational
    modifications

    Ubiquitinated, leading to proteasomal degradation.
    Phosphorylation at Tyr-707 under oxidative stress leads to translocation of TERT to the cytoplasm and reduces its antiapoptotic activity. Dephosphorylated by SHP2/PTPN11 leading to nuclear retention. Phosphorylation by the AKT pathway promotes nuclear location.
  • Cellular localization

    Nucleus > nucleolus. Nucleus > nucleoplasm. Nucleus. Chromosome > telomere. Cytoplasm. Nucleus > PML body. Shuttling between nuclear and cytoplasm depends on cell cycle, phosphorylation states, transformation and DNA damage. Diffuse localization in the nucleoplasm. Enriched in nucleoli of certain cell types. Translocated to the cytoplasm via nuclear pores in a CRM1/RAN-dependent manner involving oxidative stress-mediated phosphorylation at Tyr-707. Dephosphorylation at this site by SHP2 retains TERT in the nucleus. Translocated to the nucleus by phosphorylation by AKT.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMM9 antibody
    • DKCA2 antibody
    • DKCB4 antibody
    • EST2 antibody
    • HEST2 antibody
    • htert antibody
    • hTRT antibody
    • PFBMFT1 antibody
    • TCS1 antibody
    • Telomerase associated protein 2 antibody
    • Telomerase catalytic subunit antibody
    • Telomerase reverse transcriptase antibody
    • Telomerase-associated protein 2 antibody
    • Telomere Reverse Transcriptase antibody
    • TERT antibody
    • TERT_HUMAN antibody
    • TP2 antibody
    • TRT antibody
    see all

Images

  • Anti-Telomerase reverse transcriptase antibody (ab230527) at 1/1000 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate at 35 µg

    Developed using the ECL technique.

    Predicted band size: 127 kDa

  • Formalin-fixed, paraffin-embedded human skin tissue stained for Telomerase reverse transcriptase with ab230527 at 1/100 dilution in immunohistochemical analysis.

  • 4% PFA-fixed, 0.2% Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained forTelomerase reverse transcriptase (green) using ab230527 at 1/200 dilution followed by Alexa Fluor® 488-congugated Donkey Anti-Rabbit IgG at 1/1000 dilution in ICC/IF. 

    The nuclear counter stain is Hoechst 33342 (blue).

  • 4% PFA-fixed, 0.1% Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Telomerase reverse transcriptase (green) using ab230527 at 1/25 dilution followed by Alexa Fluor® 488-congugated Donkey Anti-Rabbit IgG at 1/400 dilution in ICC/IF. 

    The nuclear counter stain is DAPI (blue). Cytoplasmic actin is counterstained with Alexa Fluor 555® conjugated Phalloidin (red).

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Telomerase reverse transcriptase with ab230527 at 1/10 dilution (green) compared with a negative control (blue).

    FITC-conjugated goat-anti-rabbit secondary antibodies were used.

References

ab230527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up