Overview

  • Product name

  • Description

    Rabbit polyclonal to TEM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human TEM1 aa 280-320 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    CEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAG


    Database link: Q9HCU0

  • Positive control

    • Human colon carcinoma tissue; 293T cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab217535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
Flow Cyt 1/20 - 1/100.

Target

  • Function

    May play a role in tumor angiogenesis.
  • Tissue specificity

    Expressed in tumor endothelial cells but absent or barely detectable in normal endothelial cells. Expressed in metastatic lesions of the liver and during angiogenesis of corpus luteum formation and wound healing. Expressed in vascular endothelial cells of malignant tumors but not in normal blood vessels. Expressed in stromal fibroblasts.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications

    O-glycosylated with sialylated oligosaccharides.
    May be N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD164 sialomucin like 1 antibody
    • CD164L1 antibody
    • CD248 antibody
    • CD248 antigen endosialin antibody
    • CD248 molecule endosialin antibody
    • CD248_HUMAN antibody
    • Endosialin antibody
    • TEM 1 antibody
    • TEM1 antibody
    • Tumor endothelial marker 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling TEM1 with ab217535 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling TEM1 with ab217535 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Flow cytometric analysis of 293T cells labeling TEM1 with ab217535 at 1/50 dilution for 40 minutes followed by a conjugated secondary (green), compared to control cells (blue).

References

ab217535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up