Overview

  • Product name

  • Description

    Rabbit polyclonal to Tenascin C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Tenascin C aa 175-342. N-terminal tag. Expressed in E.coli.
    Sequence:

    VCEPGWKGPNCSEPECPGNCNLRGQCLDGQCICDQGFTGEDCSQLACPND CNDQGKCVNGVCVCFEGYAGLDCGLEVCPVPCSEEHGMCVDGRCVCKDGF AGEDCNEPLCFNNCNNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGR CINGTCYCEEGFTGEDCG


    Database link: B2LYI9

  • Positive control

    • IHC-P: Rat testis tissue. WB: Recombinant rat Tenascin C protein; Rat placenta and stomach lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.
  • Sequence similarities

    Belongs to the tenascin family.
    Contains 15 EGF-like domains.
    Contains 1 fibrinogen C-terminal domain.
    Contains 15 fibronectin type-III domains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 150 225 antibody
    • Cytotactin antibody
    • Glioma associated extracellular matrix antigen antibody
    • Glioma-associated-extracellular matrix antigen antibody
    • GMEM antibody
    • GP 150 225 antibody
    • GP 150-225 antibody
    • GP antibody
    • Hexabrachion antibody
    • HXB antibody
    • JI antibody
    • MGC167029 antibody
    • Miotendinous antigen antibody
    • Myotendinous antigen antibody
    • Neuronectin antibody
    • TENA_HUMAN antibody
    • Tenascin antibody
    • Tenascin-C antibody
    • Tenascin-C isoform 14/AD1/16 antibody
    • TenascinC antibody
    • TN antibody
    • TN C antibody
    • TN-C antibody
    • TNC antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for tenasin C using ab233198 at 20 µg/mL in immunohistochemical analysis.

  • Anti-Tenascin C antibody (ab233198) at 1 µg/ml + Rat placenta tissue lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
  • Anti-Tenascin C antibody (ab233198) at 1 µg/ml + Rat stomach tissue lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
  • Anti-Tenascin C antibody (ab233198) at 2 µg/ml + Recombinant rat Tenascin C protein

References

ab233198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up