Anti-Tensin 1 antibody (ab167660)
Key features and details
- Mouse polyclonal to Tensin 1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Tensin 1 antibody
See all Tensin 1 primary antibodies -
Description
Mouse polyclonal to Tensin 1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Tensin 1 aa 1-352.
Sequence:MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSK HGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTW LNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFY EDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESK GGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKC YHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGM EDGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS
Database link: Q9HBL0 -
Positive control
- Tensin 1 transfected 293T cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab167660 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. |
Target
-
Function
Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 1 C2 tensin-type domain.
Contains 1 phosphatase tensin-type domain.
Contains 1 SH2 domain. -
Post-translational
modificationsRapidly cleaved by calpain II. -
Cellular localization
Cell surface. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Localized at cell periphery preferentially to fibrillar adhesions than focal adhesions. Translocates from the cell edge to cell center in an ITGB1BP1-dependent manner. - Information by UniProt
-
Database links
- Entrez Gene: 7145 Human
- Omim: 600076 Human
- SwissProt: Q9HBL0 Human
- Unigene: 471381 Human
-
Alternative names
- matrix-remodelling associated 6 antibody
- Matrix-remodelling-associated protein 6 antibody
- MGC88584 antibody
see all
Images
Datasheets and documents
References (1)
ab167660 has been referenced in 1 publication.
- Zhou H et al. Elevated transgelin/TNS1 expression is a potential biomarker in human colorectal cancer. Oncotarget 9:1107-1113 (2018). PubMed: 29416680