Overview

  • Product name

  • Description

    Rabbit polyclonal to Tensin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Tensin 1 aa 4-307. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    SRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGG NYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNA DPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFYEDK IVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGC RPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHK KFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKVE FVFSYG


    Database link: Q9HBL0

  • Positive control

    • WB: Recombinant human Tensin 1 protein; Mouse heart lysate. IHC-P: Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 186 kDa.

Target

  • Function

    Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 C2 tensin-type domain.
    Contains 1 phosphatase tensin-type domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Rapidly cleaved by calpain II.
  • Cellular localization

    Cell surface. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Localized at cell periphery preferentially to fibrillar adhesions than focal adhesions. Translocates from the cell edge to cell center in an ITGB1BP1-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • matrix-remodelling associated 6 antibody
    • Matrix-remodelling-associated protein 6 antibody
    • MGC88584 antibody
    • MST091 antibody
    • MST122 antibody
    • MST127 antibody
    • MSTP091 antibody
    • MSTP122 antibody
    • MSTP127 antibody
    • MXRA6 antibody
    • TENS1_HUMAN antibody
    • Tensin antibody
    • Tensin-1 antibody
    • TNS antibody
    • TNS1 antibody
    see all

Images

  • Anti-Tensin 1 antibody (ab233133) at 2 µg/ml + Recombinant human Tensin 1 protein

    Predicted band size: 186 kDa

  • Anti-Tensin 1 antibody (ab233133) at 2 µg/ml + Mouse heart tissue lysate

    Predicted band size: 186 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Tensin 1 using ab233133 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up