Overview

  • Product name

  • Description

    Rabbit polyclonal to TERP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human TERP aa 241-302.
    Sequence:

    SVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVV KKMKETFKEKAK

  • Positive control

    • HeLa and HepG2 whole cell lysates; 293T, A431, H1299, MOLT4 and Raji lysates
  • General notes

    Previously labelled as PECR.

Properties

Applications

Our Abpromise guarantee covers the use of ab95999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 33 kDa.

Target

  • Function

    Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
  • Pathway

    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 4 dienoyl CoA reductase related protein antibody
    • 2 antibody
    • 4-dienoyl-CoA reductase-related protein antibody
    • DCR RP antibody
    • DCR-RP antibody
    • DCRRP antibody
    • HPDHase antibody
    • HSA250303 antibody
    • OTTHUMP00000206786 antibody
    • PECR antibody
    • PECR_HUMAN antibody
    • Peroxisomal trans 2 enoyl CoA reductase antibody
    • Peroxisomal trans-2-enoyl-CoA reductase antibody
    • PRO1004 antibody
    • Putative short chain alcohol dehydrogenase antibody
    • pVI ARL antibody
    • pVI-ARL antibody
    • PVIARL antibody
    • SDR29C1 antibody
    • Short chain dehydrogenase/reductase family 29C member 1 antibody
    • TERP antibody
    see all

Images

  • All lanes : Anti-TERP antibody (ab95999) at 1/1000 dilution

    Lane 1 : HeLa whole cell lysate
    Lane 2 : HepG2 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 33 kDa



    12% SDS-PAGE

References

ab95999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab95999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up