Overview

  • Product name

    Anti-TERP antibody - C-terminal
    See all TERP primary antibodies
  • Description

    Rabbit polyclonal to TERP - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TERP aa 194-303 (C terminal).
    Sequence:

    IRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVV CFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKM KETFKEKAKL


    Database link: Q9BY49

  • Positive control

    • WB: HEK-293T overexpressing TERP, cell lysate. IHC-P: Human liver tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as PECR.

Properties

Applications

Our Abpromise guarantee covers the use of ab224436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 33 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
  • Pathway

    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 4 dienoyl CoA reductase related protein antibody
    • 2 antibody
    • 4-dienoyl-CoA reductase-related protein antibody
    • DCR RP antibody
    • DCR-RP antibody
    • DCRRP antibody
    • HPDHase antibody
    • HSA250303 antibody
    • OTTHUMP00000206786 antibody
    • PECR antibody
    • PECR_HUMAN antibody
    • Peroxisomal trans 2 enoyl CoA reductase antibody
    • Peroxisomal trans-2-enoyl-CoA reductase antibody
    • PRO1004 antibody
    • Putative short chain alcohol dehydrogenase antibody
    • pVI ARL antibody
    • pVI-ARL antibody
    • PVIARL antibody
    • SDR29C1 antibody
    • Short chain dehydrogenase/reductase family 29C member 1 antibody
    • TERP antibody
    see all

Images

  • All lanes : Anti-TERP antibody - C-terminal (ab224436) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen), cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing PECR (co-expressed with a C-terminal myc-DDK tag), cell lysate

    Developed using the ECL technique.

    Predicted band size: 33 kDa

  • Paraffin-embedded human liver tissue stained for TERP using ab224436 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TERP (green) using ab224436 at 4 µg/ml in ICC/IF.

References

ab224436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up