Overview

  • Product name

    Anti-TESC antibody
  • Description

    Rabbit polyclonal to TESC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human TESC aa 2-214.
    Sequence:

    GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVP DLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTT MDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEK ESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMH VRFLNMETMALCH


    Database link: Q96BS2-1

  • Positive control

    • ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    TESC is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation.
  • Cellular localization

    Cytoplasm. Note: Colocalizes with SLC9A1 at the cell membrane.
  • Database links

  • Alternative names

    • 1010001A17Rik antibody
    • Calcineurin B homologous protein 3 antibody
    • CHP3 antibody
    • FLJ20607 antibody
    • MGC117906 antibody
    • OTTHUMP00000185561 antibody
    • OTTMUSP00000023573 antibody
    • TE 1 antibody
    • Tescalcin antibody
    • TSC antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells labeling TESC using ab234796 at 1/100 dilution in ICC/IF. Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

References

ab234796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up