Overview

  • Product name

    Anti-Testin antibody
  • Description

    Rabbit polyclonal to Testin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Cow, Cat, Dog, Pig, Chimpanzee, Ferret, Indian muntjac, Baboon, African green monkey, Common marmoset, Orangutan, Nomascus, Squirrel monkey, Aotus, Black lemur, Clouded leopard, Spider monkey, Colobus
  • Immunogen

    Recombinant fragment corresponding to Human Testin aa 153-277.
    Sequence:

    QLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQG PKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYA ERAGYDKLWHPACFVCSTCHELLVD


    Database link: Q9UGI8

  • Positive control

    • IHC-P: Human tonsil tissue. WB: EFO-21 cell lysate. ICC/IF: SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 48 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Scaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor. Inhibits tumor cell growth.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the prickle / espinas / testin family.
    Contains 3 LIM zinc-binding domains.
    Contains 1 PET domain.
  • Domain

    The N-terminal and the C-terminal halves of the protein can associate with each other, thereby hindering interactions with ZYX.
  • Cellular localization

    Cytoplasm. Cell junction > focal adhesion. Detected along actin stress fibers.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP586B2022 antibody
    • MGC1146 antibody
    • TES antibody
    • TES_HUMAN antibody
    • TESS 2 antibody
    • TESS antibody
    • TESS2 antibody
    • Testin antibody
    • Testis derived transcript (3 LIM domains) antibody
    • Testis derived transcript antibody
    see all

Images

  • Anti-Testin antibody (ab224375) at 1/100 dilution + EFO-21 cell lysate

    Developed using the ECL technique.

    Predicted band size: 48 kDa

  • Paraffin-embedded human tonsil tissue stained for Testin using ab224375 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for Testin (green) using ab224375 at 4 µg/ml in ICC/IF.

References

ab224375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up