Overview

  • Product name

  • Description

    Rabbit polyclonal to TET1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TET1 aa 82-205.
    Sequence:

    MNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPLVVAKSKKVPLS KGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSLL KGKSQETTQFWSQRVEDSKINIPT


    Database link: Q8NFU7

  • Positive control

    • CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Dioxygenase that catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays a role in embryonic stem (ES) cell maintenance and inner cell mass (ICM) cell specification, possibly by participating in DNA demethylation. Specifically binds 5mC, a minor base in mammalian DNA found in repetitive DNA elements that is crucial for retrotransposon silencing and mammalian development. 5mC is present in ES cells and is enriched in the brain, especially in Purkinje neurons. The clear function of hmC is still unclear but it could constitute an intermediate component in cytosine demethylation. A role of hmC in DNA demethylation is supported by TET1 function in ES cell maintenance, which is required to prevent NANOG hypermethylation and maintain NANOG expression in ES cells.
  • Tissue specificity

    Expressed in fetal heart, lung and brain, and in adult skeletal muscle, thymus and ovary. Not detected in adult heart, lung or brain.
  • Involvement in disease

    Note=A chromosomal aberration involving TET1 may be a cause of acute leukemias. Translocation t(10;11)(q22;q23) with MLL. This is a rare chromosomal translocation 5' MLL-TET1 3'.
  • Sequence similarities

    Belongs to the TET family.
    Contains 1 CXXC-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA119F7.1 antibody
    • CXXC 6 antibody
    • CXXC finger 6 antibody
    • CXXC type zinc finger protein 6 antibody
    • CXXC zinc finger 6 antibody
    • CXXC-type zinc finger protein 6 antibody
    • CXXC6 antibody
    • KIAA1676 antibody
    • LCX antibody
    • Leukemia associated protein with a CXXC domain antibody
    • Leukemia-associated protein with a CXXC domain antibody
    • Methylcytosine dioxygenase TET1 antibody
    • Ten eleven translocation 1 antibody
    • Ten eleven translocation 1 gene protein antibody
    • Ten eleven translocation 1 gene protein homolog antibody
    • Ten-eleven translocation 1 gene protein antibody
    • Tet 1 antibody
    • Tet methylcytosine dioxygenase 1 antibody
    • Tet oncogene 1 antibody
    • TET1 antibody
    • TET1_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling TET1 with ab220867 at 4 μg/ml (green).

References

ab220867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up