Overview

  • Product name

    Anti-Tetanus Toxoid antibody [3F6]
    See all Tetanus Toxoid primary antibodies
  • Description

    Mouse monoclonal [3F6] to Tetanus Toxoid
  • Host species

    Mouse
  • Specificity

    ab191896 binds to both tetanus toxin and tetanus toxoid. ab191896 does not neutralize tetanus toxin efficiently enough to protect mice in the in-vivo test of tetanus antitoxin activity.
  • Tested applications

    Suitable for: Competitive ELISA, ELISAmore details
  • Species reactivity

    Reacts with: Other species
  • Immunogen

    Full length protein corresponding to Tetanus Toxoid aa 1-1315. Formaldehyde inactivated tetanus toxin (Clostridium tetani).
    Sequence:

    MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERY EFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKN NVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTK SAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCP EYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSH EIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYK AIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQIL YNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGF NIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRE NLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKN KPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTI EIHNIDDNTIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPSVI SKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKISDVSTIVPYIGPAL NIVKQGYEGNFIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKI IKTIDNFLEKRYEKWIEVYKLVKAKWLGTVNTQFQKRSYQMYRSLEYQVD AIKKIIDYEYKIYSGPDKEQIADEINNLKNKLEEKANKAMININIFMRES SRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIGITELKKLESK INKVFSTPIPFSYSKNLDCWVDNEEDIDVILKKSTILNLDINNDIISDIS GFNSSVITYPDAQLVPGINGKAIHLVNNESSEVIVHKAMDIEYNDMFNNF TVSFWLRVPKVSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNL IWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYING VLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKE IEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMY LTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYV SYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKT YSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILG CDWYFVPTDEGWTND


    Database link: P04958

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.09% Sodium azide
    Constituents: 2.9% Sodium chloride, 97% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    3F6
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Competitive ELISA Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    Tetanus toxoid is derived from the toxin released by Clostridium Tetanis that causes the disease tetanus. It is used as a vaccine to prevent tetanus or to help boost the immune response to other vaccines. A toxoid is a substance that has been treated to destroy its toxic properties but that retains the capacity to stimulate production of antitoxins, used in immunization. Tetanus toxoid is produced by formaldehyde inactivation of pure neuro toxin. Each lot is verified to be non toxic. In addition to being a potent antigen, tetanus toxoid is a useful carrier protein for making polysaccharides and haptens immunogenic.
  • Cellular localization

    Secreted
  • Alternative names

    • Clostridium tetani toxoid antibody
    • Tentoxylysin antibody
    • Tetanus toxin antibody
    • Tetanus toxin tetX antibody
    • tetX antibody
    see all

References

ab191896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up