Overview

  • Product name

  • Description

    Rabbit polyclonal to Tetranectin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Tetranectin aa 22-202.
    Sequence:

    EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVC LKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYL RQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTE NCAVLSGAANGKWFDKRCRDQLPYICQFGIV


    Database link: P05452

  • Positive control

    • Mouse and Rat heart tissue lysates; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab202134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

Target

Images

  • Immunofluorescent analysis of HeLa cells labeling Tetranectin with ab202134 at dilution 1:50-1:200. DAPI was used for nuclear staining (Blue).

  • All lanes : Anti-Tetranectin antibody (ab202134) at 1/500 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Rat heart tissue lysate

    Predicted band size: 23 kDa

References

ab202134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up