Overview

  • Product name

  • Description

    Rabbit polyclonal to TEX101
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TEX101 aa 25-99.
    Sequence:

    ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETA ILATKGCIPEGEEAITIVQHSSPPG


    Database link: Q9BY14

  • Positive control

    • WB: Human testis tissue lysate. IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 27,29 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TEX101 may play a role in signal transduction and promote protein tyrosine phosphorylation. It is detected in testis, spermatogonia and blood leukocytes but not detected in spermatocytes. Antibodies against TEX101 are present in sera from patients with scleroderma. There are two isoforms.
  • Cellular localization

    Cell membrane; Lipid-anchor, GPI-anchor (By similarity). Note=Associated with lipid rafts (By similarity).
  • Database links

  • Alternative names

    • Cancer/testis antigen 131 antibody
    • Cell surface receptor NYD SP8 antibody
    • CT131 antibody
    • GTPR867 antibody
    • NYD-SP8 antibody
    • PRO1884 antibody
    • Scleroderma associated autoantigen antibody
    • SGRG antibody
    • SPATA44 antibody
    • Spermatogenesis associated 44 antibody
    • Spermatogenesis related gene protein antibody
    • TES101RP antibody
    • Testis expressed 101 antibody
    • Testis expressed protein 101 antibody
    • Testis expressed sequence 101 antibody
    • Testis expressed sequence 101 protein antibody
    • Testis specific protein TES101RP antibody
    • UNQ867 PRO1884 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TEX101 using ab224174 at 1/1000 dilution in immunohistochemical analysis.

  • Anti-TEX101 antibody (ab224174) at 1/100 dilution + Human testis tissue lysate

    Developed using the ECL technique.

    Predicted band size: 27,29 kDa

References

ab224174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up