Overview

  • Product name

  • Description

    Rabbit polyclonal to TFAP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TFAP4 aa 3-147.
    Sequence:

    YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREI ANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQE KTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK


    Database link: Q01664

  • Positive control

    • IHC-P: Human pancreas tissue. WB: SW620, NIH/3T3 and NBT-II cell lysates. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 38 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence 5'-CAGCTG-3'.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activating enhancer binding protein 4 antibody
    • Activating enhancer-binding protein 4 antibody
    • AP 4 antibody
    • AP4 antibody
    • bHLHc41 antibody
    • Class C basic helix-loop-helix protein 41 antibody
    • TFAP 4 antibody
    • TFAP4 antibody
    • TFAP4 protein antibody
    • TFAP4_HUMAN antibody
    • Transcription factor AP 4 antibody
    • Transcription factor AP-4 antibody
    • Transcription factor AP4 antibody
    see all

Images

  • Anti-TFAP4 antibody (ab223771) at 1/100 dilution + SW620 cell lysate

    Predicted band size: 38 kDa

  • Paraffin-embedded human pancreas tissue stained for TFAP4 using ab223771 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-TFAP4 antibody (ab223771) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 38 kDa

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for TFAP4 (green) using ab223771 at 4 µg/ml in ICC/IF.

References

ab223771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up