Anti-TFB1M antibody (ab236901)
Key features and details
- Rabbit polyclonal to TFB1M
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TFB1M antibody
See all TFB1M primary antibodies -
Description
Rabbit polyclonal to TFB1M -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human TFB1M aa 59-194.
Sequence:VYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIV HGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENI SCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRS
Database link: Q8WVM0 -
Positive control
- WB: A549 whole cell lysate. IHC-P: Human pancreatic cancer and liver cancer tissues. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. Predicted molecular weight: 39 kDa. | |
| IHC-P | 1/500 - 1/1000. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. -
Tissue specificity
Ubiquitously expressed. -
Involvement in disease
Note=Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA. -
Sequence similarities
Belongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 102130743 Cynomolgus monkey
- Entrez Gene: 51106 Human
- Entrez Gene: 100173901 Orangutan
- Omim: 607033 Human
- SwissProt: Q2PG46 Cynomolgus monkey
- SwissProt: Q8WVM0 Human
- SwissProt: Q5R4V9 Orangutan
- Unigene: 279908 Human
-
Alternative names
- N'-adenosyl(rRNA) dimethyltransferase 1 antibody
- CGI75 antibody
- Dimethyladenosine transferase 1, mitochondrial antibody
see all
Images
-
Western blot - Anti-TFB1M antibody (ab236901)Anti-TFB1M antibody (ab236901) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 39 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)Paraffin-embedded human pancreatic cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)Paraffin-embedded human liver cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunocytochemistry/ Immunofluorescence - Anti-TFB1M antibody (ab236901)HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for TFB1M (green) using ab236901 at 1/166 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236901 has not yet been referenced specifically in any publications.
