For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    tfb1m-antibody-ab236901.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Organelles Mitochondria
Share by email

Anti-TFB1M antibody (ab236901)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-TFB1M antibody (ab236901)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
  • Immunocytochemistry/ Immunofluorescence - Anti-TFB1M antibody (ab236901)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-TFB1M antibody
    See all TFB1M primary antibodies
  • Description

    Rabbit polyclonal to TFB1M
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TFB1M aa 59-194.
    Sequence:

    VYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIV HGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENI SCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRS


    Database link: Q8WVM0

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human pancreatic cancer and liver cancer tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Other factors
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial Biogenesis
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Nucleotide metabolism
    • Molecular processes
    • Mitochondrial transcription
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant Human TFB1M protein (ab113141)
  • Related Products

    • Recombinant Human TFB1M protein (ab113141)

Applications

Our Abpromise guarantee covers the use of ab236901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 39 kDa.
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Note=Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily.
  • Cellular localization

    Mitochondrion.
  • Target information above from: UniProt accession Q8WVM0 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 102130743 Cynomolgus monkey
    • Entrez Gene: 51106 Human
    • Entrez Gene: 100173901 Orangutan
    • Omim: 607033 Human
    • SwissProt: Q2PG46 Cynomolgus monkey
    • SwissProt: Q8WVM0 Human
    • SwissProt: Q5R4V9 Orangutan
    • Unigene: 279908 Human
    • Alternative names

      • N'-adenosyl(rRNA) dimethyltransferase 1 antibody
      • CGI75 antibody
      • Dimethyladenosine transferase 1, mitochondrial antibody
      • h-mtTFB antibody
      • h-mtTFB1 antibody
      • hmtTFB antibody
      • hmtTFB1 antibody
      • hTFB1M antibody
      • Mitochondrial 12S rRNA dimethylase 1 antibody
      • Mitochondrial dimethyladenosine transferase 1 antibody
      • Mitochondrial transcription factor B1 antibody
      • mtTFB1 antibody
      • S-adenosylmethionine-6-N' antibody
      • Tfb1m antibody
      • TFB1M_HUMAN antibody
      • Transcription factor B1 mitochondrial antibody
      see all

    Images

    • Western blot - Anti-TFB1M antibody (ab236901)
      Western blot - Anti-TFB1M antibody (ab236901)
      Anti-TFB1M antibody (ab236901) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate

      Secondary
      Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 39 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)

      Paraffin-embedded human pancreatic cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.

      After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)

      Paraffin-embedded human liver cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.

      After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

    • Immunocytochemistry/ Immunofluorescence - Anti-TFB1M antibody (ab236901)
      Immunocytochemistry/ Immunofluorescence - Anti-TFB1M antibody (ab236901)

      HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for TFB1M (green) using ab236901 at 1/166 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. 

    Datasheets and documents

    • Datasheet
    • SDS
  • References

    ab236901 has not yet been referenced specifically in any publications.

    Publishing research using ab236901? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab236901.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.