Anti-TFB1M antibody (ab236901)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TFB1M antibody
See all TFB1M primary antibodies -
Description
Rabbit polyclonal to TFB1M -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human TFB1M aa 59-194.
Sequence:VYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIV HGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENI SCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRS
Database link: Q8WVM0 -
Positive control
- WB: A549 whole cell lysate. IHC-P: Human pancreatic cancer and liver cancer tissues. ICC/IF: HepG2 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Predicted molecular weight: 39 kDa. | |
IHC-P | 1/500 - 1/1000. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. -
Tissue specificity
Ubiquitously expressed. -
Involvement in disease
Note=Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA. -
Sequence similarities
Belongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 102130743 Cynomolgus monkey
- Entrez Gene: 51106 Human
- Entrez Gene: 100173901 Orangutan
- Omim: 607033 Human
- SwissProt: Q2PG46 Cynomolgus monkey
- SwissProt: Q8WVM0 Human
- SwissProt: Q5R4V9 Orangutan
- Unigene: 279908 Human
-
Alternative names
- N'-adenosyl(rRNA) dimethyltransferase 1 antibody
- CGI75 antibody
- Dimethyladenosine transferase 1, mitochondrial antibody
see all
Images
-
Anti-TFB1M antibody (ab236901) at 1/500 dilution + A549 (Human lung carcinoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 39 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
Paraffin-embedded human pancreatic cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFB1M antibody (ab236901)
Paraffin-embedded human liver cancer tissue stained for TFB1M using ab236901 at 1/500 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for TFB1M (green) using ab236901 at 1/166 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C.
References
ab236901 has not yet been referenced specifically in any publications.