Overview

  • Product name

    Anti-TFF2 antibody [1-2#]
    See all TFF2 primary antibodies
  • Description

    Mouse monoclonal [1-2#] to TFF2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat TFF2 aa 27-129. N-terminal His tag. Expressed in E. coli.
    Sequence:

    SPCRCSRMTPSNRKNCGFPGITSDQCFNLGCCFDSSVAGVPWCFHPLPNQ ASEQCVMEVSARENCGYPGISPEDCASRHCCFSNLIFEVPWCFFPQSVDD CHY


    Database link: Q09030

  • Positive control

    • WB: Recombinant TFF2 protein: Rat pancreas and stomach lysate. IHC-P: Rat pancreas and stomach tissue.
  • General notes

     This product was previously labelled as Spasmolytic Polypeptide

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    1-2#
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
  • Tissue specificity

    Stomach.
  • Sequence similarities

    Contains 2 P-type (trefoil) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • SML 1 antibody
    • SML1 antibody
    • SP antibody
    • Spasmolysin antibody
    • Spasmolytic polypeptide antibody
    • spasmolytic protein 1 antibody
    • TFF 2 antibody
    • TFF2 antibody
    • TFF2_HUMAN antibody
    • trefoil factor 2 (spasmolytic protein 1) antibody
    • Trefoil factor 2 antibody
    • Trefoil factor 2 precursor antibody
    see all

Images

  • All lanes : Anti-TFF2 antibody [1-2#] (ab239488) at 2 µg/ml

    Lane 1 : Rat pancreas lysate
    Lane 2 : Rat stomach lysate

    Secondary
    All lanes : HRP-linked goat anti-mouse polyclonal IgG at 0.2 µg/ml
  • Paraffin-embedded rat pancreas tissue stained for TFF2 using ab239488 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for TFF2 using ab239488 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TFF2 antibody [1-2#] (ab239488) at 5 µg/ml + Recombinant rat TFF2 protein

References

ab239488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up