Overview

  • Product name

    Anti-TFF2 antibody [4G7C3]
    See all TFF2 primary antibodies
  • Description

    Mouse monoclonal [4G7C3] to TFF2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TFF2 aa 20-125. Expressed in E. coli.
    Sequence:

    LAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWC FHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCF FPKSVE


    Database link: Q03403

  • Positive control

    • Human TFF2 (amino acids 20-125) recombinant protein. Lysate from HEK293 cells transfected with TFF2 (amino acids 20-125). HeLa cells.
  • General notes

     This product was previously labelled as Spasmolytic Polypeptide

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    4G7C3
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 14 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
  • Tissue specificity

    Stomach.
  • Sequence similarities

    Contains 2 P-type (trefoil) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • SML 1 antibody
    • SML1 antibody
    • SP antibody
    • Spasmolysin antibody
    • Spasmolytic polypeptide antibody
    • spasmolytic protein 1 antibody
    • TFF 2 antibody
    • TFF2 antibody
    • TFF2_HUMAN antibody
    • trefoil factor 2 (spasmolytic protein 1) antibody
    • Trefoil factor 2 antibody
    • Trefoil factor 2 precursor antibody
    see all

Images

  • Anti-TFF2 antibody [4G7C3] (ab204962) at 1/500 dilution + Human TFF2 (amino acids 20-125) recombinant protein.

    Predicted band size: 14 kDa

  • All lanes : Anti-TFF2 antibody [4G7C3] (ab204962) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Lysate from HEK293 cells transfected with TFF2 (amino acids 20-125).

    Predicted band size: 14 kDa

  • Flow cytometry analysis of HeLa cells labeling TFF2 (green) using ab204962 at a 1/200 dilution (green), and negative control cells (red).

References

ab204962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up