Overview

  • Product name

  • Description

    Rabbit polyclonal to TFII I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human TFII I aa 431-569.
    Sequence:

    FVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAE ALGSTEAKAVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQV GNRIKFVIKRPELLTHSTTEVTQPRTNTPVKEDWNVRIT


    Database link: P78347

  • Positive control

    • ICC/IF: A431 cells. WB: RT4 cell lysate. IHC-P: Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Interacts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and PHOX1 and interacts cooperatively with PHOX1 to promote serum-inducible transcription of a reporter gene deriven by the C-FOS serum response element (SRE). Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box. Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation.
  • Tissue specificity

    Ubiquitous. Isoform 1 is strongly expressed in fetal brain, weakly in adult brain, muscle, and lymphoblasts and is almost undetectable in other adult tissues, while the other isoforms are equally expressed in all adult tissues.
  • Involvement in disease

    Note=GTF2I is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of GTF2I may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities

    Belongs to the TFII-I family.
    Contains 6 GTF2I-like repeats.
  • Post-translational
    modifications

    Transiently phosphorylated on tyrosine residues by BTK in response to B-cell receptor stimulation. Phosphorylation on Tyr-248 and Tyr-398, and perhaps, on Tyr-503 contributes to BTK-mediated transcriptional activation.
    Sumoylated.
  • Cellular localization

    Cytoplasm. Nucleus. Colocalizes with BTK in the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAP 135 antibody
    • BAP-135 antibody
    • BAP135 antibody
    • Bruton tyrosine kinase associated protein 135 antibody
    • Bruton tyrosine kinase-associated protein 135 antibody
    • BTK associated protein 135 antibody
    • BTK associated protein 135kD antibody
    • BTK associated protein antibody
    • BTK-associated protein 135 antibody
    • BTKAP 1 antibody
    • BTKAP1 antibody
    • DIWS antibody
    • FLJ38776 antibody
    • FLJ56355 antibody
    • General transcription factor II i antibody
    • General transcription factor II-I antibody
    • General transcription factor IIi antibody
    • GTF 2I antibody
    • Gtf2i antibody
    • GTF2I_HUMAN antibody
    • GTFII I antibody
    • GTFII-I antibody
    • IB 291 antibody
    • IB291 antibody
    • SPIN antibody
    • SRF Phox 1 interacting protein antibody
    • SRF Phox1 interacting protein antibody
    • SRF-Phox1-interacting protein antibody
    • TFII-I antibody
    • Transcription factor II I antibody
    • WBS antibody
    • WBSCR 6 antibody
    • WBSCR6 antibody
    • Williams Beuren syndrome chromosome region 6 antibody
    • Williams Beuren syndrome chromosome region 6 protein antibody
    • Williams-Beuren syndrome chromosomal region 6 protein antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TFII I (green) using ab244401 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human stomach tissue stained for TFII I using ab244401 at 1/20 dilution in immunohistochemical analysis.
  • Anti-TFII I antibody (ab244401) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate
  • All lanes : Anti-TFII I antibody (ab244401) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate

References

ab244401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up